FGFR2 Antibody

Images

 
Western Blot: FGF R2 Antibody [NBP2-56776] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: FGF R2 Antibody [NBP2-56776] - Staining of human cell line U-2 OS shows localization to vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FGFR2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKR
Specificity
Specificity of human FGF R2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FGFR2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
FGFR2 Knockout 293T Cell Lysate
Control Peptide
FGFR2 Recombinant Protein Antigen (NBP2-56776PEP)

Reactivity Notes

Mouse 82%, Rat 85%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for FGFR2 Antibody

  • BBDS
  • BEK
  • BFR-1
  • CD332 antigen
  • CD332
  • CEK3
  • CFD1
  • craniofacial dysostosis 1
  • EC 2.7.10
  • EC 2.7.10.1
  • ECT1
  • FGF R2
  • FGFR2
  • fibroblast growth factor receptor 2
  • FLJ98662
  • Jackson-Weiss syndrome
  • JWS
  • Keratinocyte growth factor receptorreceptor like 14
  • KGFR
  • KSAM
  • K-sam
  • soluble FGFR4 variant 4
  • TK14
  • TK25

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1287
Species: Hu, Mu, Rt, Rb
Applications: WB, Flow, IHC, IP, CyTOF-ready
NBP2-66840
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
AF1280
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-87528
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-56776
Species: Hu
Applications: WB, ICC/IF

Publications for FGFR2 Antibody (NBP2-56776) (0)

There are no publications for FGFR2 Antibody (NBP2-56776).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGFR2 Antibody (NBP2-56776) (0)

There are no reviews for FGFR2 Antibody (NBP2-56776). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FGFR2 Antibody (NBP2-56776) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FGFR2 Products

Bioinformatics Tool for FGFR2 Antibody (NBP2-56776)

Discover related pathways, diseases and genes to FGFR2 Antibody (NBP2-56776). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGFR2 Antibody (NBP2-56776)

Discover more about diseases related to FGFR2 Antibody (NBP2-56776).
 

Pathways for FGFR2 Antibody (NBP2-56776)

View related products by pathway.

PTMs for FGFR2 Antibody (NBP2-56776)

Learn more about PTMs related to FGFR2 Antibody (NBP2-56776).
 

Research Areas for FGFR2 Antibody (NBP2-56776)

Find related products by research area.

Blogs on FGFR2

There are no specific blogs for FGFR2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGFR2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FGFR2