FGFR1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

FGFR1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FGFR1.
  
  

  Source: E. coli

  Amino Acid Sequence: LPEQAQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTR

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: FGFR1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33784.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FGFR1 Recombinant Protein Antigen

• basic fibroblast growth factor receptor 1
• BFGFR
• bFGF-R-1
• CD331 antigen
• CD331
• CEK
• EC 2.7.10
• EC 2.7.10.1
• FGF R1
• FGFBR
• FGFR1
• FGFR-1
• fibroblast growth factor receptor 1
• FLGH3
• FLJ99988
• Flt-2
• FLT2H4
• Fms-like tyrosine kinase 2
• fms-related tyrosine kinase 2
• H2
• H5
• HBGFR
• heparin-binding growth factor receptor
• hydroxyaryl-protein kinase
• KAL 2
• KAL2
• N-SAM
• OGD
• Proto-oncogene c-Fgr
• soluble FGFR1 variant 1
• soluble FGFR1 variant 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for FGFR1 Recombinant Protein Antigen (NBP2-33784PEP). (Showing 1 - 2 of 2 FAQ).

1. I would like to inquire whether you have samples of the following antibodies: NBP1-61338, NB600-1287, NBP1-19481, NBP1-19864; The datasheets for these antibodies show different molecular weights of the detected proteins so its no altogether clear to me which one detects the real protein. To sort this out, we would be using FGFR1-deficient cells and would very much appreciate if you could supply us with small aliquots of these antibodies.
   • FGFR1 has multiple isoforms and is subject to multiple PTM's. The molecular weight can vary greatly depending on experimental conditions and samples used. We fully guarantee all of our products for the listed applications and species. If you cannot get a product to work in an application or species stated on our datasheet, our technical service team will troubleshoot with you to get it to work. If a product still does not work after troubleshooting, you can receive a free of charge replacement product or a full refund. Due to our 100% guarantee, we do not offer free of charge samples of our products. If a smaller sample size is available, it will be listed on our product page.
2. I am working in Multiple sclerosis group and mainly working with mice model and cell culture study. I need FGFR1 antibody against Mice for FACS analysis. If it is available can I get the sample to check with my cells? And any Oligodendrocyte markers against mice for FACS too.
   • We do have an antibody that has been tested in FLOW, NB600-1287, however it has not been tested in mouse. If you would like to test this antibody in mouse samples we have an Innovators Reward Program where we reward you for trying our antibody in species and applications that have not been previously tested.

Bioinformatics

• Gene Symbol: FGFR1