Recombinant Human FGFBP2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FGFBP2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-223 of Human FGFBP2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTYWCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFFRG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
FGFBP2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FGFBP2 Protein

  • 37 kDa killer-specific secretory protein
  • FGF-Binding Protein 2
  • FGFBP2
  • FGF-BP2
  • FGFBP-2
  • fibroblast growth factor binding protein 2
  • fibroblast growth factor-binding protein 2
  • HBP17RP
  • HBp17-RP
  • killer-specific secretory protein of 37 kDa
  • KSP37
  • KSP37HBp17-related protein

Background

This gene encodes a member of the fibroblast growth factor binding protein family. The encoded protein is a serum protein that is selectively secreted by cytotoxic lymphocytes and may be involved in cytotoxic lymphocyte-mediated immunity. An increase in the amount of gene product may be associated with atopic asthma and mild extrinsic asthma.[provided by RefSeq Staff]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77306
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP1-90925
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-83837
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB2546
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-27946
Species: Mu
Applications: B/N, Flow, IHC-Fr, IP
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP2-14081
Species: Hu
Applications: IHC, IHC-P
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for FGFBP2 Recombinant Protein (H00083888-P01) (0)

There are no publications for FGFBP2 Recombinant Protein (H00083888-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGFBP2 Recombinant Protein (H00083888-P01) (0)

There are no reviews for FGFBP2 Recombinant Protein (H00083888-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGFBP2 Recombinant Protein (H00083888-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FGFBP2 Products

Bioinformatics Tool for FGFBP2 Recombinant Protein (H00083888-P01)

Discover related pathways, diseases and genes to FGFBP2 Recombinant Protein (H00083888-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGFBP2 Recombinant Protein (H00083888-P01)

Discover more about diseases related to FGFBP2 Recombinant Protein (H00083888-P01).
 

Pathways for FGFBP2 Recombinant Protein (H00083888-P01)

View related products by pathway.

Research Areas for FGFBP2 Recombinant Protein (H00083888-P01)

Find related products by research area.

Blogs on FGFBP2

There are no specific blogs for FGFBP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FGFBP2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FGFBP2
Entrez