FGF-5 Antibody

Western Blot: FGF-5 Antibody [H00002250-B01P] - Analysis of FGF5 expression in transfected 293T cell line by FGF5 polyclonal antibody. Lane 1: FGF5 transfected lysate(13.53 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: FGF-5 Antibody [H00002250-B01P] - Analysis of purified antibody to FGF5 on HeLa cell. (antibody concentration 10 ug/ml)

Product Discontinued

FGF-5 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: FGF5 (NP_149134, 1 a.a. - 123 a.a.) full-length human protein. MSLSFLLLLFFSHLILSAWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSQVHR
• Specificity: Reacts with fibroblast growth factor 5.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: FGF5
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: This antibody is reactive against transfected lysate in WB, IF and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FGF-5 Antibody

• FGF5
• FGF-5
• fibroblast growth factor 5
• HBGF-5
• Heparin-binding growth factor 5
• Smag-82

Background

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified as an oncogene, which confers transforming potential when transfected into mammalian cells. Targeted disruption of the homolog of this gene in mouse resulted in the phenotype of abnormally long hair, which suggested a function as an inhibitor of hair elongation. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FGF5
• Entrez:
  • 2250(Human)
• Uniprot:
  • NP_149134(Human)