FGF-12 Antibody

Images

 
Western Blot: FGF-12 Antibody [H00002257-D01P] - Analysis of FGF12 expression in transfected 293T cell line by FGF12 polyclonal antibody.Lane 1: FGF12 transfected lysate(27.40 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FGF-12 Antibody Summary

Immunogen
FGF12 (NP_066360.1, 1 a.a. - 243 a.a.) full-length human protein. MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRPEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
Specificity
FGF12 - fibroblast growth factor 12,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FGF12
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FGF-12 Antibody

  • FGF12
  • FGF-12
  • FGF12B
  • FHF1
  • FHF-1
  • FHF1Fibroblast growth factor homologous factor 1
  • fibroblast growth factor 12
  • fibroblast growth factor 12B
  • fibroblast growth factor FGF-12b
  • Myocyte-activating factor

Background

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82600
Species: Hu
Applications: IHC, IHC-P
MAB319
Species: Hu
Applications: WB, IHC
NBP2-55745
Species: Hu
Applications: ICC/IF
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
MAB766
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF1634
Species: Hu
Applications: WB
AF238
Species: Hu
Applications: WB, Neut
NB300-137
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
28100002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-31411
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1085
Species: Mu
Applications: WB, IHC, Neut

Publications for FGF-12 Antibody (H00002257-D01P) (0)

There are no publications for FGF-12 Antibody (H00002257-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF-12 Antibody (H00002257-D01P) (0)

There are no reviews for FGF-12 Antibody (H00002257-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGF-12 Antibody (H00002257-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FGF-12 Products

Bioinformatics Tool for FGF-12 Antibody (H00002257-D01P)

Discover related pathways, diseases and genes to FGF-12 Antibody (H00002257-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF-12 Antibody (H00002257-D01P)

Discover more about diseases related to FGF-12 Antibody (H00002257-D01P).
 

Pathways for FGF-12 Antibody (H00002257-D01P)

View related products by pathway.

PTMs for FGF-12 Antibody (H00002257-D01P)

Learn more about PTMs related to FGF-12 Antibody (H00002257-D01P).
 

Research Areas for FGF-12 Antibody (H00002257-D01P)

Find related products by research area.

Blogs on FGF-12

There are no specific blogs for FGF-12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGF-12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FGF12
Entrez
Uniprot