FGF-11 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFN |
| Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FGF11 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for FGF-11 Antibody - BSA Free
Background
FGF11 encodes a 225 amino acid long, 25 kDA fibroblast growth factor 11 protein that probably acts in nervous system development and function as it is a member of the fibroblast growth factor (FGF) family. Its exact function is unknown but the pattern of expression in mouse homolog implies this nervous system development. FGF11 is associated with breast cancer, melanoma, adenocarcinoma, and pancreatitis. It participates in the regulation of actin cytoskeleton, melanoma, MAPK signaling pathway, paxillian interaction, telomerase components in cell signaling, and mitochondrial apoptosis. FGF11 is known to interact with genes: EGFR, FGFR1, FGFR2, FGFR3, and FGFR4.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, Neut, Simple Western, WB
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC, IHC, Neut, WB
Publications for FGF-11 Antibody (NBP2-62694) (0)
There are no publications for FGF-11 Antibody (NBP2-62694).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FGF-11 Antibody (NBP2-62694) (0)
There are no reviews for FGF-11 Antibody (NBP2-62694).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for FGF-11 Antibody (NBP2-62694) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FGF-11 Products
Research Areas for FGF-11 Antibody (NBP2-62694)
Find related products by research area.
|
Blogs on FGF-11