FGF-11 Antibody

Images

 
Immunohistochemistry-Paraffin: FGF-11 Antibody [NBP2-62694] - Staining of human adrenal gland shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: FGF-11 Antibody [NBP2-62694] - Analysis in human adrenal gland and pancreas tissues using Anti-FGF11 antibody. Corresponding FGF11 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: FGF-11 Antibody [NBP2-62694] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

FGF-11 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFN
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FGF11
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for FGF-11 Antibody

  • FGF11
  • FGF-11
  • FHF-3
  • FHF3Fibroblast growth factor homologous factor 3
  • fibroblast growth factor 11
  • FLJ16061
  • MGC102953
  • MGC45269

Background

FGF11 encodes a 225 amino acid long, 25 kDA fibroblast growth factor 11 protein that probably acts in nervous system development and function as it is a member of the fibroblast growth factor (FGF) family. Its exact function is unknown but the pattern of expression in mouse homolog implies this nervous system development. FGF11 is associated with breast cancer, melanoma, adenocarcinoma, and pancreatitis. It participates in the regulation of actin cytoskeleton, melanoma, MAPK signaling pathway, paxillian interaction, telomerase components in cell signaling, and mitochondrial apoptosis. FGF11 is known to interact with genes: EGFR, FGFR1, FGFR2, FGFR3, and FGFR4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-35009
Species: Hu
Applications: PAGE, WB
NBP3-04588
Species: Hu, Mu, Rt
Applications: WB
251-KG/CF
Species: Hu
Applications: BA
345-FG/CF
Species: Hu
Applications: BA
273-F9/CF
Species: Hu
Applications: BA
NBP2-88869
Species: Hu
Applications: IHC, IHC-P, WB
232-FA/CF
Species: Hu
Applications: BA
423-F8
Species: Hu, Mu
Applications: BA
7460-F4/CF
Species: Hu
Applications: BA
1206-F3/CF
Species: Hu
Applications: BA
233-FB/CF
Species: Hu
Applications: BA
MAB319
Species: Hu
Applications: IHC, WB
3867-FG/CF
Species: Hu
Applications: BA
2246-FG/CF
Species: Hu
Applications: BA
2547-FG/CF
Species: Hu
Applications: BA
AF6755
Species: Mu
Applications: IHC
DVE00
Species: Hu
Applications: ELISA
7754-BH/CF
Species: Hu
Applications: BA
AF1212
Species: Hu, Mu
Applications: ICC, IHC, Neut, WB
AF6240
Species: Hu
Applications: ELISA, IHC, WB

Publications for FGF-11 Antibody (NBP2-62694) (0)

There are no publications for FGF-11 Antibody (NBP2-62694).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF-11 Antibody (NBP2-62694) (0)

There are no reviews for FGF-11 Antibody (NBP2-62694). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FGF-11 Antibody (NBP2-62694) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FGF-11 Products

Bioinformatics Tool for FGF-11 Antibody (NBP2-62694)

Discover related pathways, diseases and genes to FGF-11 Antibody (NBP2-62694). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF-11 Antibody (NBP2-62694)

Discover more about diseases related to FGF-11 Antibody (NBP2-62694).
 

Pathways for FGF-11 Antibody (NBP2-62694)

View related products by pathway.

PTMs for FGF-11 Antibody (NBP2-62694)

Learn more about PTMs related to FGF-11 Antibody (NBP2-62694).
 

Research Areas for FGF-11 Antibody (NBP2-62694)

Find related products by research area.

Blogs on FGF-11

There are no specific blogs for FGF-11, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGF-11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FGF11