Home » FGF-11 » FGF-11 Antibodies » FGF-11 Antibody

FGF-11 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: FGF-11 Antibody [NBP2-62694] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: FGF-11 Antibody [NBP2-62694] - Staining of human adrenal gland shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: FGF-11 Antibody [NBP2-62694] - Analysis in human adrenal gland and pancreas tissues using Anti-FGF11 antibody. Corresponding FGF11 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: FGF-11 Antibody [NBP2-62694] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

FGF-11 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFN
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FGF11
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for FGF-11 Antibody

  • FGF11
  • FGF-11
  • FHF-3
  • FHF3Fibroblast growth factor homologous factor 3
  • fibroblast growth factor 11
  • FLJ16061
  • MGC102953
  • MGC45269

Background

FGF11 encodes a 225 amino acid long, 25 kDA fibroblast growth factor 11 protein that probably acts in nervous system development and function as it is a member of the fibroblast growth factor (FGF) family. Its exact function is unknown but the pattern of expression in mouse homolog implies this nervous system development. FGF11 is associated with breast cancer, melanoma, adenocarcinoma, and pancreatitis. It participates in the regulation of actin cytoskeleton, melanoma, MAPK signaling pathway, paxillian interaction, telomerase components in cell signaling, and mitochondrial apoptosis. FGF11 is known to interact with genes: EGFR, FGFR1, FGFR2, FGFR3, and FGFR4.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Recombinant Human
FGF-13 Protein
NBP2-35009
SDS-Page: Human FGF-13 Protein [NBP2-35009]
(2 Publications)
Species: Hu
Applications: PAGE, WB
FGF14 Antibody
NBP3-04588
Western Blot: FGF14 Antibody [NBP3-04588] - Analysis of extracts of various cell lines, using FGF14 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit
Species: Hu, Mu, Rt
Applications: WB
KGF/FGF-7
[Unconjugated]
251-KG/CF
Recombinant Human KGF/FGF-7 (Catalog # 251-KG/CF) stimulates cell proliferation of 4MBr-5 rhesus monkey epithelial cells. The ED50 for this effect is 6‑60 ng/mL.
(74 Publications)
Species: Hu
Applications: BA
FGF-10
[Unconjugated]
345-FG/CF
1 μg/lane of Recombinant Human FGF-10 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 21 kDa.
Recombinant Human FGF-10 (Catalog # 345-FG/CF) stimulates cell proliferation of the 4MBr‑5 rhesus monkey epithelial cell line. The ED50 for this effect is 20‑100 ng/mL.
(81 Publications)
Species: Hu
Applications: BA
FGF-9
[Unconjugated]
273-F9/CF
Recombinant human FGF-9 (273-F9/CF) induces proliferation in the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 1-5 ng/mL.
(41 Publications)
Species: Hu
Applications: BA
FGF18 Antibody
(CL7628)
NBP2-88869
Immunohistochemistry-Paraffin: FGF18 Antibody (CL7628) [NBP2-88869] - Analysis in human heart muscle and liver tissues using AMAb91480 antibody. Corresponding FGF18 RNA-seq data are presented for the same tissues.i
Western Blot: FGF18 Antibody (CL7628) [NBP2-88869] - Analysis in human plasma.
Immunohistochemistry-Paraffin: FGF18 Antibody (CL7628) [NBP2-88869] - Staining in human Fallopian tube shows moderate positivity of secretion under the gladular cell layer.
Species: Hu
Applications: IHC, IHC-P, WB
FGF acidic/FGF1
[Unconjugated]
232-FA/CF
FGF acidic/FGF1 [Unconjugated]
(19 Publications)
Species: Hu
Applications: BA
FGF-8
[Unconjugated]
423-F8
1 μg/lane of Recombinant Human/Mouse FGF-8b was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 23 kDa.
Recombinant Human/Mouse FGF-8b (Catalog # 423-F8) stimulates cell proliferation in the NR6R‑3T3 mouse fibroblast cell line. The ED50 for this effect is 6.5-40 ng/mL in the presence of 1 μg/mL heparin.
(1 Review)
(57 Publications)
Species: Hu, Mu
Applications: BA
FGF-4
[Unconjugated]
7460-F4/CF
FGF-4 [Unconjugated]
(2 Publications)
Species: Hu
Applications: BA
FGF-3
[Unconjugated]
1206-F3/CF
FGF-3 [Unconjugated]
(11 Publications)
Species: Hu
Applications: BA
FGF
basic/FGF2/bFGF [Unco
233-FB/CF
Recombinant Human FGF basic/FGF2/bFGF (146 aa) (Catalog # 233-FB/CF) stimulates cell proliferation of the NR6R‑3T3 mouse fibroblast cell line. The activity is approximately 3-fold greater than the top competitor's FGF basic (146 aa).
1 µg/lane of Recombinant Human FGF basic/FGF2/bFGF (146 aa) was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(471 Publications)
Species: Hu
Applications: BA
FGF-17 Antibody
(121630)
MAB319
FGF‑17 was detected in immersion fixed paraffin-embedded sections of human kidney using Human FGF‑17 Monoclonal Antibody (Catalog # MAB319) at 8 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Specific labeling was localized to the basement membrane supporting epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: IHC, WB
FGF-22
3867-FG/CF
FGF-22
(5 Publications)
Species: Hu
Applications: BA
FGF-12
[Unconjugated]
2246-FG/CF
When Recombinant rhFGF R4/Fc Chimera (685-FR) is immobilized at 2 μg/mL (100 μL/well), it binds to Recombinant Human FGF-12 (Catalog # 2246-FG/CF) with an ED50 of 3-18 ng/mL.
(2 Publications)
Species: Hu
Applications: BA
FGF-20
[Unconjugated]
2547-FG/CF
Recombinant human FGF-20 (2547-FG/CF) stimulates proliferation in the NR6R-3T3 mouse fibroblast cell line. The ED50 for this effect is 0.2-1 ng/mL in the presence of 1 µg/mL of heparin.
(5 Publications)
Species: Hu
Applications: BA
FGF-15 Antibody
AF6755
FGF-15 was detected in immersion fixed frozen sections of mouse embryo (E15) using Sheep Anti-Mouse FGF-15 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6755) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to the processes of dorsal root ganglia neurons. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(1 Publication)
Species: Mu
Applications: IHC
VEGF [HRP]
DVE00
(621 Publications)
Species: Hu
Applications: ELISA
TGF-beta 1
[Unconjugated]
7754-BH/CF
Recombinant human TGF-beta 1 (7754-BH/CF) inhibits recombinant mouse IL-4 induced proliferation in the HT-2 mouse T cell line. The ED50 for this effect is 0.04-0.2 ng/mL.
(21 Publications)
Species: Hu
Applications: BA
FGF-16 Antibody
[Unconjugated]
AF1212
Recombinant Human FGF‑16 (Catalog # 1212-FG) stimulates proliferation in the NR6R‑3T3 mouse fibroblast cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human FGF‑16 (100 ng/mL) is neutralized (green line) by increasing concentrations of Sheep Anti-Human/Mouse FGF‑16 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1212). The ND50 is typically 3-9 µg/mL.
FGF‑16 was detected in immersion fixed paraffin-embedded sections of human heart using Sheep Anti-Human/Mouse FGF‑16 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1212) at 3 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to cardiomyocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
FGF‑16 was detected in perfusion fixed frozen sections of mouse embryo (13 d.p.c.) using Sheep Anti-Human/Mouse FGF‑16 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1212) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to roots of dorsal ganglia and spinal cord. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Species: Hu, Mu
Applications: ICC, IHC, Neut, WB
Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western blot shows lysates of LNCaP human prostate cancer cell line. PVDF Membrane was probed with 1 µg/mL of Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Prostatic Acid Phosphatase/ACPP at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Prostatic Acid Phosphatase/ACPP was detected in immersion fixed paraffin-embedded sections of human prostate using Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hemotoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Recombinant Human Prostatic Acid Phosphatase/ACPP protein was serially diluted 2-fold and captured by Mouse Anti-Human Prostatic Acid Phosphatase/ACPP Monoclonal Antibody (Catalog # MAB62401) coated on a Clear Polystyrene Microplate (Catalog # DY990). Sheep Anti-Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
(1 Publication)
Species: Hu
Applications: ELISA, IHC, WB

Publications for FGF-11 Antibody (NBP2-62694) (0)

There are no publications for FGF-11 Antibody (NBP2-62694).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF-11 Antibody (NBP2-62694) (0)

There are no reviews for FGF-11 Antibody (NBP2-62694). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FGF-11 Antibody (NBP2-62694) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FGF-11 Products

Bioinformatics Tool for FGF-11 Antibody (NBP2-62694)

Discover related pathways, diseases and genes to FGF-11 Antibody (NBP2-62694). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF-11 Antibody (NBP2-62694)

Discover more about diseases related to FGF-11 Antibody (NBP2-62694).
 

Pathways for FGF-11 Antibody (NBP2-62694)

View related products by pathway.

PTMs for FGF-11 Antibody (NBP2-62694)

Learn more about PTMs related to FGF-11 Antibody (NBP2-62694).
 

Research Areas for FGF-11 Antibody (NBP2-62694)

Find related products by research area.

Blogs on FGF-11

There are no specific blogs for FGF-11, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGF-11 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol FGF11