FFAR3/GPR41 Antibody

Images

 
Immunohistochemistry-Paraffin: FFAR3/GPR41 Antibody [NBP2-14014] - Staining of human small intestine shows strong membranous and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FFAR3/GPR41 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGC GTGGQVAC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FFAR3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FFAR3/GPR41 Protein (NBP2-14014PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FFAR3/GPR41 Antibody

  • FFA3
  • FFA3R
  • FFAR3
  • free fatty acid receptor 3
  • G protein-coupled receptor 41
  • GPR41
  • GPR41FFA3R
  • G-protein coupled receptor 41

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS6599
Species: Hu, Mk, Pm
Applications: IHC-P
NB100-1537
Species: Hu
Applications: WB, PEP-ELISA
NBP1-00858
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NLS548
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-80865
Species: Hu
Applications: IHC, IHC-P
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NBP2-04289
Species: Hu
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-46125
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IF
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-14014
Species: Hu
Applications: IHC, IHC-P

Publications for FFAR3/GPR41 Antibody (NBP2-14014) (0)

There are no publications for FFAR3/GPR41 Antibody (NBP2-14014).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FFAR3/GPR41 Antibody (NBP2-14014) (0)

There are no reviews for FFAR3/GPR41 Antibody (NBP2-14014). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FFAR3/GPR41 Antibody (NBP2-14014) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FFAR3/GPR41 Products

Bioinformatics Tool for FFAR3/GPR41 Antibody (NBP2-14014)

Discover related pathways, diseases and genes to FFAR3/GPR41 Antibody (NBP2-14014). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FFAR3/GPR41 Antibody (NBP2-14014)

Discover more about diseases related to FFAR3/GPR41 Antibody (NBP2-14014).
 

Pathways for FFAR3/GPR41 Antibody (NBP2-14014)

View related products by pathway.

PTMs for FFAR3/GPR41 Antibody (NBP2-14014)

Learn more about PTMs related to FFAR3/GPR41 Antibody (NBP2-14014).
 

Research Areas for FFAR3/GPR41 Antibody (NBP2-14014)

Find related products by research area.

Blogs on FFAR3/GPR41

There are no specific blogs for FFAR3/GPR41, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FFAR3/GPR41 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FFAR3
Entrez