FEM1B Recombinant Protein Antigen

Images

 
There are currently no images for FEM1B Protein (NBP1-89422PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FEM1B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FEM1B.

Source: E.coli

Amino Acid Sequence: NDRENYDIIKTYHYLYLAMLERFQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRERILGADNIDVSHPIIY

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FEM1B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-89422.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for FEM1B Recombinant Protein Antigen

  • DKFZp451E0710
  • F1AA
  • F1A-alpha
  • FEM-1 (C.elegans) homolog b
  • fem-1 homolog b (C. elegans)
  • FEM1b
  • FEM1-beta
  • FEM-1-like death receptor binding protein
  • Fem-1-like death receptor-binding protein alpha
  • Fem-1-like in apoptotic pathway protein alpha
  • FIAA
  • KIAA0396
  • protein fem-1 homolog B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32501
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57434
Species: Hu
Applications: ICC/IF
AF800
Species: Hu, Mu
Applications: WB, Simple Western, IP
NBP2-59315
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-1768
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84304
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56074
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00010745-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-00612
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-57485
Species: Hu
Applications: WB, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-1828
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29950
Species: Hu, Mu
Applications: WB, Flow, IHC-P
NBP2-14010
Species: Hu
Applications: IHC, IHC-P
NBP1-82819
Species: Hu
Applications: WB, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89422PEP
Species: Hu
Applications: AC

Publications for FEM1B Protein (NBP1-89422PEP) (0)

There are no publications for FEM1B Protein (NBP1-89422PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FEM1B Protein (NBP1-89422PEP) (0)

There are no reviews for FEM1B Protein (NBP1-89422PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for FEM1B Protein (NBP1-89422PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for FEM1B Protein (NBP1-89422PEP)

Discover related pathways, diseases and genes to FEM1B Protein (NBP1-89422PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FEM1B Protein (NBP1-89422PEP)

Discover more about diseases related to FEM1B Protein (NBP1-89422PEP).
 

Pathways for FEM1B Protein (NBP1-89422PEP)

View related products by pathway.

PTMs for FEM1B Protein (NBP1-89422PEP)

Learn more about PTMs related to FEM1B Protein (NBP1-89422PEP).
 

Research Areas for FEM1B Protein (NBP1-89422PEP)

Find related products by research area.

Blogs on FEM1B

There are no specific blogs for FEM1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FEM1B Antibody
NBP1-77300

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FEM1B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FEM1B