Recombinant Human FEM1B GST (N-Term) Protein

SDS-Page: Recombinant Human FEM1B Protein [H00010116-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human FEM1B GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acids 401-490 of Human FEM1B partial ORF
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: TVKAPDIECVLRCSVLEIEQSMNRVKNISDADVHNAMDNYECNLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIHLDPRTREGFTLLHL

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: FEM1B
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FEM1B GST (N-Term) Protein

• DKFZp451E0710
• F1AA
• F1A-alpha
• FEM-1 (C.elegans) homolog b
• fem-1 homolog b (C. elegans)
• FEM1b
• FEM1-beta
• FEM-1-like death receptor binding protein
• Fem-1-like death receptor-binding protein alpha
• Fem-1-like in apoptotic pathway protein alpha
• FIAA
• KIAA0396
• protein fem-1 homolog B

Background

Fas and tumor necrosis factor receptor 1 (TNFR1) are two prototype members in the death receptor family. A novel protein that associates with the intracellular domains of Fas and TNFR1 was recently identified and designated F1Aa and FEM1b (1,2). F1Aa/FEM1b is the homologue of C. elegans sex determining protein FEM-1. FEM-1/F1Aa is cleaved by CED-3 and caspase (3). FEM-1/F1Aa associates with CED-4 and its mammalian homologue Apaf-1 (3). Overexpression of F1Aa induces apoptosis. F1Aa is therefore a novel member of the death receptor associated protein that mediates apoptosis. F1Aa is expressed in a variety of human and mouse tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: FEM1B