Recombinant Human FEM1B GST (N-Term) Protein Summary
| Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 401-490 of Human FEM1B partial ORF Source: Wheat Germ (in vitro) Amino Acid Sequence: TVKAPDIECVLRCSVLEIEQSMNRVKNISDADVHNAMDNYECNLYTFLYLVCISTKTQCSEEDQCKINKQIYNLIHLDPRTREGFTLLHL |
Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source |
Wheat germ |
| Protein/Peptide Type |
Partial Recombinant Protein |
| Gene |
FEM1B |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- SDS-Page
- Western Blot
|
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human FEM1B GST (N-Term) Protein
Background
Fas and tumor necrosis factor receptor 1 (TNFR1) are two prototype members in the death receptor family. A novel protein that associates with the intracellular domains of Fas and TNFR1 was recently identified and designated F1Aa and FEM1b (1,2). F1Aa/FEM1b is the homologue of C. elegans sex determining protein FEM-1. FEM-1/F1Aa is cleaved by CED-3 and caspase (3). FEM-1/F1Aa associates with CED-4 and its mammalian homologue Apaf-1 (3). Overexpression of F1Aa induces apoptosis. F1Aa is therefore a novel member of the death receptor associated protein that mediates apoptosis. F1Aa is expressed in a variety of human and mouse tissues.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu, Rt
Applications: PEP-ELISA, WB
Species: Hu
Applications: ELISA, IHC, WB
Species: Hu, Mu
Applications: IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP
Publications for FEM1B Partial Recombinant Protein (H00010116-Q01) (0)
There are no publications for FEM1B Partial Recombinant Protein (H00010116-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FEM1B Partial Recombinant Protein (H00010116-Q01) (0)
There are no reviews for FEM1B Partial Recombinant Protein (H00010116-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FEM1B Partial Recombinant Protein (H00010116-Q01) (0)
Additional FEM1B Products
Research Areas for FEM1B Partial Recombinant Protein (H00010116-Q01)
Find related products by research area.
|
Blogs on FEM1B