FEM1B Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FEM1B Antibody [NBP1-89422] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: FEM1B Antibody [NBP1-89422] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FEM1B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NDRENYDIIKTYHYLYLAMLERFQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRERILGADNIDVSHPIIY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FEM1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FEM1B Protein (NBP1-89422PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FEM1B Antibody

  • DKFZp451E0710
  • F1AA
  • F1A-alpha
  • FEM-1 (C.elegans) homolog b
  • fem-1 homolog b (C. elegans)
  • FEM1b
  • FEM1-beta
  • FEM-1-like death receptor binding protein
  • Fem-1-like death receptor-binding protein alpha
  • Fem-1-like in apoptotic pathway protein alpha
  • FIAA
  • KIAA0396
  • protein fem-1 homolog B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32501
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57434
Species: Hu
Applications: ICC/IF
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-71805
Species: Hu
Applications: WB, IP
NB100-464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PLA
NBP1-84304
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56074
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00010745-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-00612
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-57485
Species: Hu
Applications: WB, ICC/IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-1828
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29950
Species: Hu, Mu
Applications: WB, Flow, IHC-P
NBP2-14010
Species: Hu
Applications: IHC, IHC-P
NBP1-82819
Species: Hu
Applications: WB, IHC, IHC-P
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-89422
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for FEM1B Antibody (NBP1-89422) (0)

There are no publications for FEM1B Antibody (NBP1-89422).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FEM1B Antibody (NBP1-89422) (0)

There are no reviews for FEM1B Antibody (NBP1-89422). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FEM1B Antibody (NBP1-89422) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FEM1B Products

Bioinformatics Tool for FEM1B Antibody (NBP1-89422)

Discover related pathways, diseases and genes to FEM1B Antibody (NBP1-89422). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FEM1B Antibody (NBP1-89422)

Discover more about diseases related to FEM1B Antibody (NBP1-89422).
 

Pathways for FEM1B Antibody (NBP1-89422)

View related products by pathway.

PTMs for FEM1B Antibody (NBP1-89422)

Learn more about PTMs related to FEM1B Antibody (NBP1-89422).
 

Research Areas for FEM1B Antibody (NBP1-89422)

Find related products by research area.

Blogs on FEM1B

There are no specific blogs for FEM1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FEM1B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FEM1B