FEM1B Antibody

Analysis in control (vector-only transfected HEK293T lysate) and FEM1B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells.

Product Discontinued

FEM1B Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NDRENYDIIKTYHYLYLAMLERFQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRERILGADNIDVSHPIIY
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FEM1B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.04-0.4 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FEM1B Antibody

• DKFZp451E0710
• F1AA
• F1A-alpha
• FEM-1 (C.elegans) homolog b
• fem-1 homolog b (C. elegans)
• FEM1b
• FEM1-beta
• FEM-1-like death receptor binding protein
• Fem-1-like death receptor-binding protein alpha
• Fem-1-like in apoptotic pathway protein alpha
• FIAA
• KIAA0396
• protein fem-1 homolog B

Background

Fas and tumor necrosis factor receptor 1 (TNFR1) are two prototype members in the death receptor family. A novel protein that associates with the intracellular domains of Fas and TNFR1 was recently identified and designated F1Aa and FEM1b (1,2). F1Aa/FEM1b is the homologue of C. elegans sex determining protein FEM-1. FEM-1/F1Aa is cleaved by CED-3 and caspase (3). FEM-1/F1Aa associates with CED-4 and its mammalian homologue Apaf-1 (3). Overexpression of F1Aa induces apoptosis. F1Aa is therefore a novel member of the death receptor associated protein that mediates apoptosis. F1Aa is expressed in a variety of human and mouse tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FEM1B