FDPS Antibody

Images

 
Western Blot: FDPS Antibody [NBP1-89509] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: FDPS Antibody [NBP1-89509] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: FDPS Antibody [NBP1-89509] - Staining of human liver shows cytoplasmic and nuclear positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FDPS Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SLVHGYPVLAWHSARCWCQAWTEEPRALCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAIGGKYN
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FDPS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FDPS Protein (NBP1-89509PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FDPS Antibody

  • 6E)-farnesyl diphosphate synthase
  • Dimethylallyltranstransferase
  • EC 2.5.1.1
  • EC 2.5.1.10
  • farnesyl diphosphate synthaseFPP synthetase
  • farnesyl pyrophosphate synthase
  • farnesyl pyrophosphate synthetase, dimethylallyltranstransferase
  • FPP synthase
  • FPPS
  • FPSgeranyltranstransferase
  • Geranyltranstransferase
  • KIAA1293

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83368
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-16984
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31475
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01170
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB6460
Species: Hu
Applications: WB, IHC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF8516
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-33908
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FDPS Antibody (NBP1-89509) (0)

There are no publications for FDPS Antibody (NBP1-89509).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FDPS Antibody (NBP1-89509) (0)

There are no reviews for FDPS Antibody (NBP1-89509). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FDPS Antibody (NBP1-89509) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FDPS Products

Bioinformatics Tool for FDPS Antibody (NBP1-89509)

Discover related pathways, diseases and genes to FDPS Antibody (NBP1-89509). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FDPS Antibody (NBP1-89509)

Discover more about diseases related to FDPS Antibody (NBP1-89509).
 

Pathways for FDPS Antibody (NBP1-89509)

View related products by pathway.

PTMs for FDPS Antibody (NBP1-89509)

Learn more about PTMs related to FDPS Antibody (NBP1-89509).
 

Research Areas for FDPS Antibody (NBP1-89509)

Find related products by research area.

Blogs on FDPS

There are no specific blogs for FDPS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FDPS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FDPS