Recombinant Human FCRN/FCGRT Protein

Product Discontinued

Recombinant Human FCRN/FCGRT Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 51-160 of Human FCRN/FCGRT
  
  

  Source: Wheat Germ

  Amino Acid Sequence: GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAI

• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Partial Recombinant Protein
• Gene: FCGRT
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 37.84 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FCRN/FCGRT Protein

• alpha-chain
• Fc fragment of IgG, receptor, transporter, alpha
• FCGRT
• FcRn alpha chain
• FCRN
• FCRNimmunoglobulin receptor, intestinal, heavy chain
• IgG Fc fragment receptor transporter alpha chain
• IgG receptor FcRn large subunit p51
• major histocompatibility complex class I-like Fc receptor
• Neonatal Fc receptor
• neonatal Fc-receptor for Ig

Background

FCGRT - Fc fragment of IgG, receptor, transporter, alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for FCRN/FCGRT Partial Recombinant Protein (H00002217-Q01)(1)

Publication using H00002217-Q01

• Deissler HL, Lang GK, Lang GE. Internalization of bevacizumab by retinal endothelial cells and its intracellular fate: Evidence for an involvement of the neonatal Fc receptor. Exp Eye Res 2016-02-01 [PMID: 26481553]

FAQs for FCRN/FCGRT Partial Recombinant Protein (H00002217-Q01). (Showing 1 - 1 of 1 FAQ).

1. Can you please confirm whether the following items are both related to neonatal Fc receptor? NBL1-10660 & H00002217-Q01
   • Both of these products are of the Fc fragment of IgG, receptor, transporter, alpha (FCGRT). One is an overexpression lysate and the other is a purified partial recombinant protein. Our description of the gene is as follows This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. This appears to be the neonatal Fc receptor.

Bioinformatics

• Gene Symbol: FCGRT