We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human FCRN/FCGRT Protein

Images

 

Product Details

Summary
Product Discontinued
View other related FCRN/FCGRT Peptides and Proteins

Order Details


    • Catalog Number
      H00002217-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human FCRN/FCGRT Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 51-160 of Human FCRN/FCGRT

Source: Wheat Germ

Amino Acid Sequence: GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAI

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FCGRT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00002217-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FCRN/FCGRT Protein

  • alpha-chain
  • Fc fragment of IgG, receptor, transporter, alpha
  • FCGRT
  • FcRn alpha chain
  • FCRN
  • FCRNimmunoglobulin receptor, intestinal, heavy chain
  • IgG Fc fragment receptor transporter alpha chain
  • IgG receptor FcRn large subunit p51
  • major histocompatibility complex class I-like Fc receptor
  • Neonatal Fc receptor
  • neonatal Fc-receptor for Ig

Background

FCGRT - Fc fragment of IgG, receptor, transporter, alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
4325-FC
Species: Hu
Applications: Bind
MEP00B
Species: Mu
Applications: ELISA
NBP1-87492
Species: Hu
Applications: IHC,  IHC-P, WB
NB600-922
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
NBP2-46123
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB7446
Species: Hu
Applications: CyTOF-ready, Flow
NB100-64852
Species: Hu
Applications: Flow, IF, IHC, IHC-Fr
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
1257-FC
Species: Hu
Applications: Bind
H00003077-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
H00002217-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for FCRN/FCGRT Partial Recombinant Protein (H00002217-Q01)(1)

Reviews for FCRN/FCGRT Partial Recombinant Protein (H00002217-Q01) (0)

There are no reviews for FCRN/FCGRT Partial Recombinant Protein (H00002217-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FCRN/FCGRT Partial Recombinant Protein (H00002217-Q01). (Showing 1 - 1 of 1 FAQ).

  1. Can you please confirm whether the following items are both related to neonatal Fc receptor? NBL1-10660 & H00002217-Q01
    • Both of these products are of the Fc fragment of IgG, receptor, transporter, alpha (FCGRT). One is an overexpression lysate and the other is a purified partial recombinant protein. Our description of the gene is as follows This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. This appears to be the neonatal Fc receptor.

Additional FCRN/FCGRT Products

Blogs on FCRN/FCGRT.

FcRn - neonatal Fc receptor encoded by the FCGRT gene
Antibodies play an important role in the innate immune system by circulating in the bloodstream to fight off invading pathogens. IgG is the most prevalent of the five classes of antibodies (IgA, IgD, IgE, IgG, and IgM) and is the only one transmit...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FCRN/FCGRT Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FCGRT