FCER1G Antibody - BSA Free

Western Blot: FCER1G Antibody [NBP2-84930] - WB Suggested Anti-FCER1G Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Hela cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

FCER1G Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FCER1G. Peptide sequence: MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FCER1G
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for FCER1G Antibody - BSA Free

• Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide
• Fc-epsilon RI-gamma
• FceRI gamma
• FCRG
• high affinity immunoglobulin epsilon receptor subunit gamma
• IgE Fc receptor subunit gamma
• immunoglobulin E receptor, high affinity, gamma chain

Background

The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha,1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FCER1G