FBXW8 Antibody - BSA Free

Immunohistochemistry-Paraffin: FBXW8 Antibody [NBP1-84715] - Staining in human thyroid gland and skeletal muscle tissues using anti-FBXW8 antibody. Corresponding FBXW8 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: FBXW8 Antibody [NBP1-84715] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: FBXW8 Antibody [NBP1-84715] - Staining of human thyroid gland shows high expression.

Immunohistochemistry-Paraffin: FBXW8 Antibody [NBP1-84715] - Staining of human skeletal muscle shows low expression as expected.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FBXW8 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KLIFQECRAKEHMLQTNWKNRKGAVSELEHVPDTVLCDVHSHDGVVIAGYTSGDVRVWDTRTWDYVAPFLESEDEEDEPGMQPNVSFVRINSSLAVAA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FBXW8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC, WB reported in the scientific literature (PMID: 25790475).
• Control Peptide:

  FBXW8 Protein (NBP1-84715PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (87%). Human reactivity reported in scientific literature (PMID: 25790475).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FBXW8 Antibody - BSA Free

• F-box and WD repeat domain containing 8
• F-box only protein 29F-box/WD repeat-containing protein 8
• FBW8F-box and WD-40 domain-containing protein 8
• FBX29MGC33534
• FBXO29
• FBXW6FBW6F-box and WD-40 domain protein 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FBXW8 Antibody (NBP1-84715)(2)

Publications using NBP1-84715

• Halbach MV, Stehning T, Damrath E et al. Both Ubiquitin Ligases FBXW8 and PARK2 Are Sequestrated into Insolubility by ATXN2 PolyQ Expansions, but Only FBXW8 Expression Is Dysregulated. PLoS One 2015-01-01 [PMID: 25790475] (IF/IHC, WB, Human)
• Fahlbusch FB, Dawood Y, Hartner A et al. Cullin 7 and Fbxw 8 expression in trophoblastic cells is regulated via oxygen tension: implications for intrauterine growth restriction?. J Matern Fetal Neonatal Med 2012-11-01 [PMID: 22524683]

Bioinformatics

• Gene Symbol: FBXW8