FBXW5 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit FBXW5 Antibody - BSA Free (NBP2-87437) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human FBXW5. Peptide sequence: NDLTISLLHSADMRPYNWSYTQFSQFNKDDSLLLASGVFLGPHNSSSGEI The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
FBXW5 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for FBXW5 Antibody - BSA Free
Background
The FBXW5 gene encodes a F-box/WD repeat-containing protein 5 that exists in two isoforms. Isoform 1 is 556 amino acids long, at nearly 64 kDA while isoform 2 is 377 amino acids long at 42 kDA. This protein encoded by this gene functions in substrate recognition of SCF as well as DCX E3 ubiquitin-protein ligase complexes. It may also work as a negative regulator of MAP3K7/TAK1 signaling in the interleukin-1B signaling pathway. FBXW5 participates in protein chaperonin-mediated protein folding and metabolism as well as the association of TriC/CCT with target proteins during biosynthesis. It is known to interact with genes CUL1, MDFI, SKP1, KRTAP4-12, and UBE2R2. FBXW5 is associated with tuberous sclerosis as well as hepatitis b.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, WB
Species: Mu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Av, Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Publications for FBXW5 Antibody (NBP2-87437) (0)
There are no publications for FBXW5 Antibody (NBP2-87437).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FBXW5 Antibody (NBP2-87437) (0)
There are no reviews for FBXW5 Antibody (NBP2-87437).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FBXW5 Antibody (NBP2-87437) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FBXW5 Products
Research Areas for FBXW5 Antibody (NBP2-87437)
Find related products by research area.
|
Blogs on FBXW5