Recombinant Human FBXL7 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human FBXL7 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-491 of Human FBXL7 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGANNGKQYGSEGKGSSSISSDVSSSTDHTPTKAQKNVATSEDSDLSMRTLSTPSPALICPPNLPGFQNGRGSSTSSSSITGETVAMVHSPPPTRLTHPLIRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGETINVDRALKVLTRRLCQDTPNVCLMLETVTVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLRRCVRLTDEGLRYLVIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGRVTDVGIRYVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGLECLALNCFNLKRLSLKSCESITGQGLQIVAANCFDLQTLNVQDCEVSVEALRFVKRHCKRCVIEHTNPAFF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
FBXL7

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FBXL7 Protein

  • FBL7FBL6F-box protein Fbl7
  • F-box and leucine-rich repeat protein 7F-box protein FBL6/FBL7
  • F-box/LRR-repeat protein 7
  • KIAA0840

Background

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80695
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP1-55046
Species: Hu
Applications: WB
H00003400-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-88831
Species: Hu
Applications: WB, IHC, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-88466
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-563
Species: Hu
Applications: WB, IHC-P, IP
NBP1-91244
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87744
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20287
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-83408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4146
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-83118
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00023194-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for FBXL7 Recombinant Protein (H00023194-P01) (0)

There are no publications for FBXL7 Recombinant Protein (H00023194-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXL7 Recombinant Protein (H00023194-P01) (0)

There are no reviews for FBXL7 Recombinant Protein (H00023194-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBXL7 Recombinant Protein (H00023194-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FBXL7 Products

Bioinformatics Tool for FBXL7 Recombinant Protein (H00023194-P01)

Discover related pathways, diseases and genes to FBXL7 Recombinant Protein (H00023194-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXL7 Recombinant Protein (H00023194-P01)

Discover more about diseases related to FBXL7 Recombinant Protein (H00023194-P01).
 

Pathways for FBXL7 Recombinant Protein (H00023194-P01)

View related products by pathway.

PTMs for FBXL7 Recombinant Protein (H00023194-P01)

Learn more about PTMs related to FBXL7 Recombinant Protein (H00023194-P01).

Blogs on FBXL7

There are no specific blogs for FBXL7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FBXL7 Antibody
NBP1-55053

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FBXL7 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXL7