Recombinant Human Fbx32 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Fbx32 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 210 of Human FBXO32 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSGKGQLDWKKMYFKLVRCYPRKEQYGDTLQLRKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
FBXO32
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00114907-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Fbx32 Protein

  • atrogin 1
  • ATROGIN1
  • atrogin-1
  • F-box only protein 32
  • F-box protein 32
  • Fbx32
  • FLJ32424
  • MAFBX
  • MAFbxMGC33610
  • Muscle atrophy F-box protein

Background

FBXO32( AAH24030, 1 a.a. - 211 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31207
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Fbx32 Recombinant Protein (H00114907-P01)(1)

Reviews for Fbx32 Recombinant Protein (H00114907-P01) (0)

There are no reviews for Fbx32 Recombinant Protein (H00114907-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fbx32 Recombinant Protein (H00114907-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Fbx32 Products

Bioinformatics Tool for Fbx32 Recombinant Protein (H00114907-P01)

Discover related pathways, diseases and genes to Fbx32 Recombinant Protein (H00114907-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fbx32 Recombinant Protein (H00114907-P01)

Discover more about diseases related to Fbx32 Recombinant Protein (H00114907-P01).
 

Pathways for Fbx32 Recombinant Protein (H00114907-P01)

View related products by pathway.

PTMs for Fbx32 Recombinant Protein (H00114907-P01)

Learn more about PTMs related to Fbx32 Recombinant Protein (H00114907-P01).

Blogs on Fbx32

There are no specific blogs for Fbx32, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Fbx32 Antibody
NBP1-97856

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Fbx32 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXO32