Recombinant Human Fbx32 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Fbx32 GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 210 of Human FBXO32 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTLVQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSGKGQLDWKKMYFKLVRCYPRKEQYGDTLQLRKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
FBXO32
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
48.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using H00114907-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Fbx32 GST (N-Term) Protein

  • atrogin 1
  • ATROGIN1
  • atrogin-1
  • F-box only protein 32
  • F-box protein 32
  • Fbx32
  • FLJ32424
  • MAFBX
  • MAFbxMGC33610
  • Muscle atrophy F-box protein

Background

FBXO32( AAH24030, 1 a.a. - 211 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5366
Species: Hu, Mu, Rt
Applications: Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
788-G8/CF
Species: Hu, Mu, Rt
Applications: BA
NB100-614
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, IP, KD, KO, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-98549
Species: Hu
Applications: WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, NULL, WB
NBP2-31376
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-56510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-56708
Species: Ch, ChHa, Hu, Ma, Mu, Po, Rt
Applications: CyTOF-ready, EM, Flow, HEStain, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, KD, KO, Simple Western, WB
NB200-157
Species: Hu
Applications: IHC, IHC-P, KO, WB

Publications for Fbx32 Recombinant Protein (H00114907-P01)(1)

Reviews for Fbx32 Recombinant Protein (H00114907-P01) (0)

There are no reviews for Fbx32 Recombinant Protein (H00114907-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fbx32 Recombinant Protein (H00114907-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Fbx32 Products

Bioinformatics Tool for Fbx32 Recombinant Protein (H00114907-P01)

Discover related pathways, diseases and genes to Fbx32 Recombinant Protein (H00114907-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fbx32 Recombinant Protein (H00114907-P01)

Discover more about diseases related to Fbx32 Recombinant Protein (H00114907-P01).
 

Pathways for Fbx32 Recombinant Protein (H00114907-P01)

View related products by pathway.

PTMs for Fbx32 Recombinant Protein (H00114907-P01)

Learn more about PTMs related to Fbx32 Recombinant Protein (H00114907-P01).

Blogs on Fbx32

There are no specific blogs for Fbx32, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Fbx32 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXO32