Recombinant Human FBX09 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human FBX09 Protein [H00026268-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human FBX09 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 338-447 of Human FBX09

Source: Wheat Germ (in vitro)

Amino Acid Sequence: HYRLSQDTDNQTKVFAVITKKKEEKPLDYKYRYFRRVPVQEADQSFHVGLQLCSSGHQRFNKLIWIHHSCHITYKSTGETAVSAFEIDKMYTPLFFARVRSYTAFSERPL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FBXO9
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FBX09 GST (N-Term) Protein

  • Cross-immune reaction antigen 1
  • dJ341E18.2
  • F-box only protein 9
  • F-box protein 9
  • F-box protein Fbx9
  • FBX9DKFZp434C0118
  • KIAA0936
  • NY-REN-57
  • Renal carcinoma antigen NY-REN-57
  • VCIA1

Background

FBXO9 - F-box protein 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006934-M06
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
NBP2-76836
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
DIP100
Species: Hu
Applications: ELISA
AF5366
Species: Hu, Mu, Rt
Applications: Simple Western, WB
NBP3-04614
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-89105
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14292
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87799
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84721
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
DY2057
Species: Mu
Applications: ELISA
NB100-614
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, IP, KD, KO, WB
NBP2-29661
Species: Hu, Mu, Rt
Applications: ELISA
H00006925-M03
Species: Hu, Pm, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
AF4377
Species: Hu, Mu
Applications: ICC, Simple Western, WB
NBP2-02665
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB300-549
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00002729-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
H00026268-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for FBX09 Partial Recombinant Protein (H00026268-Q01) (0)

There are no publications for FBX09 Partial Recombinant Protein (H00026268-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBX09 Partial Recombinant Protein (H00026268-Q01) (0)

There are no reviews for FBX09 Partial Recombinant Protein (H00026268-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FBX09 Partial Recombinant Protein (H00026268-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FBX09 Products

Bioinformatics Tool for FBX09 Partial Recombinant Protein (H00026268-Q01)

Discover related pathways, diseases and genes to FBX09 Partial Recombinant Protein (H00026268-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBX09 Partial Recombinant Protein (H00026268-Q01)

Discover more about diseases related to FBX09 Partial Recombinant Protein (H00026268-Q01).
 

Pathways for FBX09 Partial Recombinant Protein (H00026268-Q01)

View related products by pathway.

Blogs on FBX09

There are no specific blogs for FBX09, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FBX09 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXO9