LRTM2 Antibody

Images

 
Western Blot: LRTM2 Antibody [NBP2-30649] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: LRTM2 Antibody [NBP2-30649] - Staining of human cerebral cortex shows moderate positivity.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

LRTM2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NNSIRTLDRDLLRHSPLLRHLDLSINGLAQLPPGLFDGLLALRSLSLRSNRLQNLDRLTFEPLANLQLLQVGDNPWECDCNLREFKHWME
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LRTM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
LRTM2 Protein (NBP2-30649PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LRTM2 Antibody

  • Leucine-Rich Repeat And Transmembrane Domain-Containing Protein 2
  • Leucine-Rich Repeats And Transmembrane Domains 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85920
Species: Hu
Applications: IHC, IHC-P
NBP1-28641
Species: Hu, Mu, Rt, Mk
Applications: WB, IHC, IHC-P
NBP2-33296
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82018
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92521
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24393
Species: Hu
Applications: WB
H00006223-M01
Species: Hu
Applications: WB, ELISA
NBP1-88177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for LRTM2 Antibody (NBP2-30649) (0)

There are no publications for LRTM2 Antibody (NBP2-30649).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LRTM2 Antibody (NBP2-30649) (0)

There are no reviews for LRTM2 Antibody (NBP2-30649). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LRTM2 Antibody (NBP2-30649) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LRTM2 Products

LRTM2 NBP2-30649

Bioinformatics Tool for LRTM2 Antibody (NBP2-30649)

Discover related pathways, diseases and genes to LRTM2 Antibody (NBP2-30649). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LRTM2 Antibody (NBP2-30649)

Discover more about diseases related to LRTM2 Antibody (NBP2-30649).
 

Pathways for LRTM2 Antibody (NBP2-30649)

View related products by pathway.

Blogs on LRTM2

There are no specific blogs for LRTM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LRTM2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LRTM2
Uniprot