| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Rabbit Fatty acid desaturase 2 Antibody - Azide and BSA Free (NBP3-03260) is a polyclonal antibody validated for use in WB. Anti-Fatty acid desaturase 2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-131 of human Fatty acid desaturase 2 (NP_004256.1). MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMNLFKTNHV |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FADS2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP3-03260 | Applications | Species |
|---|---|---|
| Wu J, Luo J, He Q et al. Docosahexaenoic Acid Alters Lipid Metabolism Processes via H3K9ac Epigenetic Modification in Dairy Goat Journal of agricultural and food chemistry 2023-05-24 [PMID: 37224334] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Fatty acid desaturase 2 Antibody (NBP3-03260)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FADS2 |