Fatty acid desaturase 2 Antibody - Azide and BSA Free

Western Blot: Fatty acid desaturase 2 Antibody [NBP3-03260] - Analysis of extracts of various cell lines, using FADS2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Fatty acid desaturase 2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit Fatty acid desaturase 2 Antibody - Azide and BSA Free (NBP3-03260) is a polyclonal antibody validated for use in WB. Anti-Fatty acid desaturase 2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-131 of human Fatty acid desaturase 2 (NP_004256.1). MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMNLFKTNHV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FADS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Fatty acid desaturase 2 Antibody - Azide and BSA Free

• D6D
• D6DLLCDL2
• Delta(6) desaturase
• Delta(6) fatty acid desaturase
• Delta-6 desaturase
• delta-6 fatty acid desaturase
• delta-6-desaturase
• DES6
• EC 1.14.19
• EC 1.14.19.-
• EC 1.14.19.3
• FADS2
• FADSD6
• Fatty acid desaturase 2
• linoleoyl-CoA desaturase (delta-6-desaturase)-like 2
• SLL0262
• TU13

Background

The protein encoded by the Fatty acid desaturase 2 gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Fatty acid desaturase 2 Antibody (NBP3-03260)(1)

Publication using NBP3-03260

• Wu J, Luo J, He Q et al. Docosahexaenoic Acid Alters Lipid Metabolism Processes via H3K9ac Epigenetic Modification in Dairy Goat Journal of agricultural and food chemistry 2023-05-24 [PMID: 37224334]

Bioinformatics

• Gene Symbol: FADS2