FATP3/SLC27A3 Antibody

Images

 
Western Blot: FATP3/SLC27A3 Antibody [NBP1-59839] - PANC1 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: FATP3/SLC27A3 Antibody [NBP1-59839] - Antibody Titration: 1 ug/ml Human MCF7.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit

Order Details

FATP3/SLC27A3 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC27A3 (solute carrier family 27 (fatty acid transporter), member 3) The peptide sequence was selected from the middle region of SLC27A3)(50ug). Peptide sequence PFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQS
Clonality
Polyclonal
Host
Rabbit
Gene
SLC27A3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SLC27A3 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
79 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FATP3/SLC27A3 Antibody

  • ACSVL3
  • EC 6.2.1
  • EC 6.2.1.-
  • EC 6.2.1.7
  • FATP3
  • FATP-3
  • FATP3ACSVL3MGC4365
  • Fatty acid transport protein 3
  • long-chain fatty acid transport protein 3
  • SLC27A3
  • solute carrier family 27 (fatty acid transporter), member 3
  • Solute carrier family 27 member 3
  • Very long-chain acyl-CoA synthetase homolog 3
  • VLCS-3

Background

SLC27A3 has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids.SLC27A3 does not exhibit fatty acid transport activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

FAB3650A
Species: Hu
Applications: Flow
MAB3304
Species: Hu
Applications: ICC, ICFlow
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-90152
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7766
Species: Hu
Applications: WB, IHC
NBP2-37738
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-91645
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89600
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89600
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57960
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37412
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP1-26393
Species: Hu
Applications: WB, ICC/IF
H00002181-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB110-99585
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
NB100-92012
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-28722
Species: Hu
Applications: WB, IP

Publications for FATP3/SLC27A3 Antibody (NBP1-59839) (0)

There are no publications for FATP3/SLC27A3 Antibody (NBP1-59839).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FATP3/SLC27A3 Antibody (NBP1-59839) (0)

There are no reviews for FATP3/SLC27A3 Antibody (NBP1-59839). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FATP3/SLC27A3 Antibody (NBP1-59839) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FATP3/SLC27A3 Antibody Products

Related Products by Gene

Bioinformatics Tool for FATP3/SLC27A3 Antibody (NBP1-59839)

Discover related pathways, diseases and genes to FATP3/SLC27A3 Antibody (NBP1-59839). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FATP3/SLC27A3 Antibody (NBP1-59839)

Discover more about diseases related to FATP3/SLC27A3 Antibody (NBP1-59839).
 

Pathways for FATP3/SLC27A3 Antibody (NBP1-59839)

View related products by pathway.

PTMs for FATP3/SLC27A3 Antibody (NBP1-59839)

Learn more about PTMs related to FATP3/SLC27A3 Antibody (NBP1-59839).

Blogs on FATP3/SLC27A3

There are no specific blogs for FATP3/SLC27A3, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol SLC27A3
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-59839 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought