FATP3/SLC27A3 Antibody


Western Blot: FATP3/SLC27A3 Antibody [NBP1-59839] - PANC1 cell lysate, concentration 0.2-1 ug/ml.
Western Blot: FATP3/SLC27A3 Antibody [NBP1-59839] - Antibody Titration: 1 ug/ml Human MCF7.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

FATP3/SLC27A3 Antibody Summary

Synthetic peptides corresponding to SLC27A3 (solute carrier family 27 (fatty acid transporter), member 3) The peptide sequence was selected from the middle region of SLC27A3)(50ug). Peptide sequence PFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQS
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against SLC27A3 and was validated on Western blot.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
79 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FATP3/SLC27A3 Antibody

  • ACSVL3
  • EC 6.2.1
  • EC 6.2.1.-
  • EC
  • FATP3
  • FATP-3
  • Fatty acid transport protein 3
  • long-chain fatty acid transport protein 3
  • SLC27A3
  • solute carrier family 27 (fatty acid transporter), member 3
  • Solute carrier family 27 member 3
  • Very long-chain acyl-CoA synthetase homolog 3
  • VLCS-3


SLC27A3 has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids.SLC27A3 does not exhibit fatty acid transport activity.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: Flow
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, IP

Publications for FATP3/SLC27A3 Antibody (NBP1-59839) (0)

There are no publications for FATP3/SLC27A3 Antibody (NBP1-59839).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FATP3/SLC27A3 Antibody (NBP1-59839) (0)

There are no reviews for FATP3/SLC27A3 Antibody (NBP1-59839). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FATP3/SLC27A3 Antibody (NBP1-59839) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FATP3/SLC27A3 Antibody Products

Related Products by Gene

Bioinformatics Tool for FATP3/SLC27A3 Antibody (NBP1-59839)

Discover related pathways, diseases and genes to FATP3/SLC27A3 Antibody (NBP1-59839). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FATP3/SLC27A3 Antibody (NBP1-59839)

Discover more about diseases related to FATP3/SLC27A3 Antibody (NBP1-59839).

Pathways for FATP3/SLC27A3 Antibody (NBP1-59839)

View related products by pathway.

PTMs for FATP3/SLC27A3 Antibody (NBP1-59839)

Learn more about PTMs related to FATP3/SLC27A3 Antibody (NBP1-59839).

Blogs on FATP3/SLC27A3

There are no specific blogs for FATP3/SLC27A3, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our FATP3/SLC27A3 Antibody and receive a gift card or discount.


Gene Symbol SLC27A3

Customers Who Bought This Also Bought