FAT10 Antibody


Western Blot: FAT10 Antibody [NBP2-13498] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: FAT10 Antibody [NBP2-13498] - Staining of human cell line U-251 MG shows positivity in nucleoli.
Immunohistochemistry-Paraffin: FAT10 Antibody [NBP2-13498] - Staining of human stomach, upper shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Product Discontinued
View other related FAT10 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FAT10 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: NASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLG SKILKPRRSLSSYGIDKEKTIHLTLKVVKP
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Read Publications using NBP2-13498.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FAT10 Antibody

  • Diubiquitin
  • FAT10
  • FAT10diubiquitin
  • GABBR1
  • UBD
  • UBD-3
  • ubiquitin D
  • Ubiquitin-like protein FAT10


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Ca
Applications: WB, Flow
Species: Hu
Applications: WB, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, Flow, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: ICC
Species: Hu, Mu, Rt, Bv
Applications: WB, Simple Western, IHC, IHC-P

Publications for FAT10 Antibody (NBP2-13498)(2)

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species
Showing Publications 1 - 2 of 2.
Publications using NBP2-13498 Applications Species
Hladik F, Burgener A, Ballweber L, Gottardo R. Mucosal effects of tenofovir 1% gel. 2014 Sep 01
Hladik F, Burgener A, Ballweber L et al. Mucosal effects of tenofovir 1% gel. Elife 2015 [PMID: 25647729] (IHC) IHC

Reviews for FAT10 Antibody (NBP2-13498) (0)

There are no reviews for FAT10 Antibody (NBP2-13498). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAT10 Antibody (NBP2-13498) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FAT10 Products

Bioinformatics Tool for FAT10 Antibody (NBP2-13498)

Discover related pathways, diseases and genes to FAT10 Antibody (NBP2-13498). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAT10 Antibody (NBP2-13498)

Discover more about diseases related to FAT10 Antibody (NBP2-13498).

Pathways for FAT10 Antibody (NBP2-13498)

View related products by pathway.

PTMs for FAT10 Antibody (NBP2-13498)

Learn more about PTMs related to FAT10 Antibody (NBP2-13498).

Blogs on FAT10

There are no specific blogs for FAT10, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAT10 Antibody and receive a gift card or discount.


Gene Symbol UBD