FAT10 Antibody

Images

 
Western Blot: FAT10 Antibody [NBP2-13498] - Analysis in control (vector only transfected HEK293T lysate) and UBD over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: FAT10 Antibody [NBP2-13498] - Staining of human cell line Hep G2 shows localization to nucleus. Antibody staining is shown in green.
Immunohistochemistry for IL-10 and ubiquitin D (UBD) in rectal biopsies before (0) and after 7 days (VII) of daily tenofovir 1% gel use.Individual study participants are designated by letters. Blue indicates nuclei, ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAT10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: NASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
UBD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. Use in IHC reported in scientific literature (PMID: 25647729).
Control Peptide
FAT10 Protein (NBP2-13498PEP)
Publications
Read Publication using NBP2-13498.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAT10 Antibody

  • Diubiquitin
  • FAT10
  • FAT10diubiquitin
  • GABBR1
  • UBD
  • UBD-3
  • ubiquitin D
  • Ubiquitin-like protein FAT10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAT10 Antibody (NBP2-13498)(1)

We have publications tested in 1 application: IF/IHC.


Filter By Application
IF/IHC
(1)
All Applications
Filter By Species
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP2-13498 Applications Species
Hladik F, Burgener A, Ballweber L et al. Mucosal effects of tenofovir 1% gel. Elife 2015-01-01 [PMID: 25647729] (IF/IHC) IF/IHC

Reviews for FAT10 Antibody (NBP2-13498) (0)

There are no reviews for FAT10 Antibody (NBP2-13498). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAT10 Antibody (NBP2-13498) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAT10 Products

Research Areas for FAT10 Antibody (NBP2-13498)

Find related products by research area.

Blogs on FAT10

There are no specific blogs for FAT10, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAT10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol UBD