FAT10 Antibody (10A6T5) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 70-150 of human FAT10 (O15205). KEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGI |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
UBD |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/Immunofluorescence 1:50 - 1:200
- Western Blot 1:500 - 1:2000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Notes
"The only hazardous substance, Thimerosal, is present in this product in very small amounts as an antimicrobial preservative."
Alternate Names for FAT10 Antibody (10A6T5)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: B/N, Func-Inh, In vitro, In vivo
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: Flow, ICC/IF, PA, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, IP, WB
Publications for FAT10 Antibody (NBP3-16731) (0)
There are no publications for FAT10 Antibody (NBP3-16731).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FAT10 Antibody (NBP3-16731) (0)
There are no reviews for FAT10 Antibody (NBP3-16731).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for FAT10 Antibody (NBP3-16731) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional FAT10 Products
Bioinformatics Tool for FAT10 Antibody (NBP3-16731)
Discover related pathways, diseases and genes to FAT10 Antibody (NBP3-16731). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for FAT10 Antibody (NBP3-16731)
Discover more about diseases related to FAT10 Antibody (NBP3-16731).
| | Pathways for FAT10 Antibody (NBP3-16731)
View related products by pathway.
|
PTMs for FAT10 Antibody (NBP3-16731)
Learn more about PTMs related to FAT10 Antibody (NBP3-16731).
| | Research Areas for FAT10 Antibody (NBP3-16731)
Find related products by research area.
|
Blogs on FAT10