FAT10 Antibody (10A6T5)

Western Blot: FAT10 Antibody (10A6T5) [NBP3-16731] - Analysis of extracts of various cell lines, using FAT10 Rabbit mAb (NBP3-16731) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Immunocytochemistry/Immunofluorescence: FAT10 Antibody (10A6T5) [NBP3-16731] - Immunofluorescence analysis of U-2 OS cells using FAT10 Rabbit mAb (NBP3-16731) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: FAT10 Antibody (10A6T5) [NBP3-16731] - Immunofluorescence analysis of C6 cells using FAT10 Rabbit mAb (NBP3-16731) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/Immunofluorescence: FAT10 Antibody (10A6T5) [NBP3-16731] - Immunofluorescence analysis of NIH-3T3 cells using FAT10 Rabbit mAb (NBP3-16731) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clone: 10A6T5
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

FAT10 Antibody (10A6T5) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 70-150 of human FAT10 (O15205). KEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGI
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: UBD
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Notes

"The only hazardous substance, Thimerosal, is present in this product in very small amounts as an antimicrobial preservative."

Alternate Names for FAT10 Antibody (10A6T5)

• Diubiquitin
• FAT10
• FAT10diubiquitin
• GABBR1
• UBD
• UBD-3
• ubiquitin D
• Ubiquitin-like protein FAT10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: UBD