Home » Fascin » Fascin Antibodies » Fascin Antibody

Fascin Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Fascin Antibody [NBP1-74212] - Mouse Thymus Lysate 1ug/ml Gel Concentration 12%
Western Blot: Fascin Antibody [NBP1-74212] - Mouse Thymus Lysate 1ug/ml Gel Concentration 12%

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, GP, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Fascin Antibody Summary

Immunogen
Synthetic peptides corresponding to the N terminal of Fscn1. Immunizing peptide sequence VVAHDDGRWSLQSEAHRRYFGGTEDRLSCFAQSVSPAEKWSVHIAMHPQV.
Marker
Dendritic Cell Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FSCN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Fscn1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Fascin Antibody

  • FAN1
  • FAN1,55 kDa actin-bundling protein
  • fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus)
  • Fascin
  • FLJ38511
  • FSCN1
  • HSN
  • p55actin bundling protein
  • singed (Drosophila)-like (sea urchin fascin homolog like)
  • singed-like (fascin homolog, sea urchin)
  • Singed-like Protein
  • SNL
  • SNLfascin

Background

Fscn1 organizes filamentous actin into bundles with a minimum of 4.1:1 actin/fascin ratio. It plays a role in the organization of actin filament bundles and the formation of microspikes, membrane ruffles, and stress fibers. It is important for the formation of a diverse set of cell protrusions, such as filopodia, and for cell motility and migration

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(24 Reviews)
(588 Publications)
Species: Hu
IL-2 [Unconjugated]
202-IL
1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.
Recombinant Human IL-2 (Catalog # 202-IL) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is 0.05-0.25 ng/mL.
(17 Reviews)
(269 Publications)
Species: Hu
IL-2 R beta
Antibody (27302)
MAB224
IL‑2 R beta was detected in immersion fixed frozen sections of human lymph node using 15 µg/mL Mouse Anti-Human IL‑2 R beta Monoclonal Antibody (Catalog # MAB224) overnight at 4 °C. Tissue was stained (red) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Recombinant Human IL‑2 (Catalog # 202-IL) stimulates proliferation in the MO7e human megakaryocytic leukemic cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human IL‑2 (30 ng/mL) is neutralized (green line) by increasing concentrations of Mouse Anti-Human IL‑2 R beta Monoclonal Antibody (Catalog # MAB224). The ND50 is typically 0.05‑0.15 µg/mL.
(5 Publications)
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
CDP/CUTL1 Antibody
(2A10)
H00001523-M01
Western Blot: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - Analysis of CUX1 expression in transfected 293T cell line by CUTL1 monoclonal antibody (M01), clone 2A10.Lane 1: CUX1 transfected lysate(77.2 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - Analysis of monoclonal antibody to CUTL1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: CDP/CUTL1 Antibody (2A10) [H00001523-M01] - Analysis of monoclonal antibody to CUTL1 on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B tissue. Antibody concentration 5 ug/ml.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
LEDGF Antibody
(762815)
MAB3468
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line. Gels were loaded with 40 µg of cytoplasmic (Cyto) and 20 µg of nuclear (Nuc) extracts. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human LEDGF Monoclonal Antibody (Catalog # MAB3468) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). Specific bands were detected for LEDGF p75 at approximately 75 kDa and LEDGF p52 at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
LEDGF was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Mouse Anti-Human LEDGF Monoclonal Antibody (Catalog # MAB3468) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red, upper panel; Catalog # NL007) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, ICC
KHSRP Antibody
NBP1-18910
Western Blot: KHSRP Antibody [NBP1-18910] - Whole cell lysate (50 ug) from HeLa, 293T, Jurkat, mouse TCMK-1, and mouse NIH3T3 cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit antiKSRP antibody used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 10 seconds.
Immunohistochemistry-Paraffin: KHSRP Antibody [NBP1-18910] - FFPE section of mouse teratoma. Antibody: Affinity purified rabbit anti-KSRP used at a dilution of 1:1,000 (0.2ug/ml). Detection: DAB
Western Blot: KHSRP Antibody [NBP1-18910] - Whole cell lysate from HeLa, 293T and mouse NIH3T3 cells. KSRP was also immunoprecipitated by rabbit anti-KSRP antibody NBP1-18911.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
HCLS1 Antibody
AF5789
Western blot shows lysates of L1.2 mouse pro‑B cell line, Nb2‑11 rat lymphoma cell line, and Raji human Burkitt's lymphoma cell line. PVDF membrane was probed with 1 µg/mL of Human/Mouse/Rat HCLS1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5789) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for HCLS1 at approximately 75 to 80 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu, Rt
Applications: WB
Siglec-7/CD328
Antibody [Unconjugate
AF1138
Recombinant Human Siglec‑7 Fc Chimera (Catalog # 1138-SL), immobilized onto a microplate, supports the adhesion of human red blood cells in a dose-dependent manner (orange line). Adhesion elicited by Recombinant Human Siglec‑7 Fc Chimera (1.5 µg/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human Siglec‑7 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1138). The ND50 is typically 0.3-0.9 µg/mL.
(3 Publications)
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(1 Publication)
Species: Hu
HLA DQ Antibody
(SPV-L3)
NBP2-45041
HLA DQ Antibody (SPV-L3)
Species: Hu, Po
Applications: Flow, IHC-Fr, IF
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-NOD2 (2D9) NB100-524 at a 1:200 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was counterstained with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(16 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
IL-6 [Unconjugated]
7270-IL/CF
IL-6 [Unconjugated]
Species: Hu
IL-4
6507-IL/CF
IL-4
(3 Publications)
Species: Hu
TPPP/p25 Antibody
NBP2-34031
Western Blot: TPPP/p25 Antibody [NBP2-34031] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Cerebral cortex tissue.
Immunocytochemistry/Immunofluorescence: TPPP/p25 Antibody [NBP2-34031] - Staining of human cell line A549 shows localization to cytosol & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP2-34031] - Staining in human cerebral cortex and liver tissues using anti-TPPP antibody. Corresponding TPPP RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
IL-1 beta/IL-1F2
[Unconjugated]
201-LB
1 μg/lane of Recombinant Human IL-1 beta /IL-1F2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
Recombinant Human IL-1 beta /IL-1F2 (Catalog # 201-LB) stimulates cell proliferation of the D10.G4.1 mouse helper T cell line. The ED50 for this effect is <12 pg/mL.
(12 Reviews)
(377 Publications)
Species: Hu

Calcium-binding-protei
NBP1-33736
Western Blot: Calcium-binding-protein-P22 Antibody [NBP1-33736] - A. 50 ug mouse liver lysate/extract 12 % SDS-PAGE
Immunocytochemistry/Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP1-33736] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calcium binding protein P22 protein stained by Calcium binding protein P22 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded mouse lung. Calcium binding protein P22 antibody dilution: 1:500.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Fascin Antibody (NBP1-74212) (0)

There are no publications for Fascin Antibody (NBP1-74212).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fascin Antibody (NBP1-74212) (0)

There are no reviews for Fascin Antibody (NBP1-74212). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fascin Antibody (NBP1-74212) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Fascin Products

Bioinformatics Tool for Fascin Antibody (NBP1-74212)

Discover related pathways, diseases and genes to Fascin Antibody (NBP1-74212). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fascin Antibody (NBP1-74212)

Discover more about diseases related to Fascin Antibody (NBP1-74212).
 

Pathways for Fascin Antibody (NBP1-74212)

View related products by pathway.

PTMs for Fascin Antibody (NBP1-74212)

Learn more about PTMs related to Fascin Antibody (NBP1-74212).

Blogs on Fascin

There are no specific blogs for Fascin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fascin Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol FSCN1
Uniprot