Fas Ligand/TNFSF6 Recombinant Protein Antigen

Images

 
There are currently no images for Fas Ligand/TNFSF6 Recombinant Protein Antigen (NBP2-49160PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Fas Ligand/TNFSF6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Fas Ligand/TNFSF6.

Source: E. coli

Amino Acid Sequence: HTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FASLG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49160.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Fas Ligand/TNFSF6 Recombinant Protein Antigen

  • apoptosis (APO-1) antigen ligand 1
  • Apoptosis antigen ligand
  • APT1LG1CD95L
  • APTL
  • CD178 antigen
  • CD178
  • CD95L
  • CD95-L
  • Fas antigen ligand
  • Fas ligand (TNF superfamily, member 6)
  • Fas Ligand
  • FASLCD95 ligand
  • FASLG
  • TNFSF6
  • TNFSF6FasL
  • tumor necrosis factor (ligand) superfamily, member 6
  • tumor necrosis factor ligand superfamily member 6

Background

Fas / APO-1 (CD95) is an important member of the tumour necrosis factor (TNF) superfamily involved in membrane-mediated apoptosis. Ligation of Fas by Fas Ligand (Fas-L) or an anti-Fas cross-linking antibody, triggers activation of the caspase cascade. Functional impairment of the Fas / Fas-L system is associated with the development and progression of malignancies. Fas gene mutations have been suggested to have a role in testicular germ cell tumours. Tumour cells frequently exhibit de novo expression of Fas Ligand (Fas-L), which plays a significant role in local tissue destruction, metastatic spread, and immune escape of the tumor cells. The apoptosis of lymphocytes, which occurs in autoimmune diseases, is usually induced by the Fas/Fas-L system. Fas is believed to be involved in various autoimmune diseases including, ulcerative colitis, Graves disease, and rheumatoid arthritis. Fas expression on gastric epithelial cells in patients infected with H.Pylori is responsible for the accelerated apoptosis of the cells. Serum Fas-L concentration has also been shown to be associated with atherosclerosis and inflammatory disease, in patients with hypertension.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7398-FS
Species: Hu
Applications: BA
NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
375-TL
Species: Hu
Applications: BA
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
202-IL
Species: Hu
Applications: BA
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
AF800
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
485-MI
Species: Mu
Applications: BA
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
AF821
Species: Hu, Mu
Applications: WB
NBP2-49160PEP
Species: Hu
Applications: AC

Publications for Fas Ligand/TNFSF6 Recombinant Protein Antigen (NBP2-49160PEP) (0)

There are no publications for Fas Ligand/TNFSF6 Recombinant Protein Antigen (NBP2-49160PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fas Ligand/TNFSF6 Recombinant Protein Antigen (NBP2-49160PEP) (0)

There are no reviews for Fas Ligand/TNFSF6 Recombinant Protein Antigen (NBP2-49160PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Fas Ligand/TNFSF6 Recombinant Protein Antigen (NBP2-49160PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Fas Ligand/TNFSF6 Products

Research Areas for Fas Ligand/TNFSF6 Recombinant Protein Antigen (NBP2-49160PEP)

Find related products by research area.

Blogs on Fas Ligand/TNFSF6

There are no specific blogs for Fas Ligand/TNFSF6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Fas Ligand/TNFSF6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FASLG