Recombinant Human FANCB GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human FANCB Protein [H00002187-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human FANCB GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 750-858 of Human FANCB

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GSENFLIDNMAFTLEKELVTLSSLSSAIAKHESNFMQRCEVSKGKSSVVAAALSDRRENIHPYRKELQREKKKMLQTNLKVSGALYREITLKVAEVQLKSDFAAQKLSN

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FANCB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FANCB GST (N-Term) Protein

  • EC 2.8.1
  • EC 3.6.3.14
  • FA2
  • FAAP90
  • FAAP95FAB
  • FACB
  • Fanconi anemia group B protein
  • Fanconi anemia, complementation group B
  • Fanconi anemia-associated polypeptide of 95 kDa
  • FLJ34064
  • Protein FACB

Background

The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group B. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00171023-M05
Species: Hu
Applications: ELISA, IP, WB
NBP1-87769
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89827
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-47291
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB600-1071
Species: Hu(-), Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
1137-SL
Species: Hu
Applications: BA
AF3667
Species: Hu, Mu
Applications: ICC, IHC, Simple Western, WB
AF2335
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, IP, WB
AF972
Species: Hu
Applications: ELISA, IHC, KO, Simple Western, WB
NBP2-31368
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92025
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00027130-P02
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-37368
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IMC, IHC, IHC-P, WB
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
H00002187-Q01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for FANCB Partial Recombinant Protein (H00002187-Q01) (0)

There are no publications for FANCB Partial Recombinant Protein (H00002187-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FANCB Partial Recombinant Protein (H00002187-Q01) (0)

There are no reviews for FANCB Partial Recombinant Protein (H00002187-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FANCB Partial Recombinant Protein (H00002187-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FANCB Products

Bioinformatics Tool for FANCB Partial Recombinant Protein (H00002187-Q01)

Discover related pathways, diseases and genes to FANCB Partial Recombinant Protein (H00002187-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FANCB Partial Recombinant Protein (H00002187-Q01)

Discover more about diseases related to FANCB Partial Recombinant Protein (H00002187-Q01).
 

Pathways for FANCB Partial Recombinant Protein (H00002187-Q01)

View related products by pathway.

PTMs for FANCB Partial Recombinant Protein (H00002187-Q01)

Learn more about PTMs related to FANCB Partial Recombinant Protein (H00002187-Q01).
 

Research Areas for FANCB Partial Recombinant Protein (H00002187-Q01)

Find related products by research area.

Blogs on FANCB.

Fanconi Antibodies and Cancer Research
We at Novus Biologicals have an extensive antibody databasedevoted to the 13 Fanconi anaemia complementation (FANC) genes, which are involved in the recognition and repair of damaged DNA.The core complex of 8 proteins (FANCA, B, C, E, F, G, L and M)...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FANCB GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FANCB