FAM83B Antibody - BSA Free

Immunohistochemistry-Paraffin: FAM83B Antibody [NBP1-86764] - Staining in human skin and liver tissues using anti-FAM83B antibody. Corresponding FAM83B RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: FAM83B Antibody [NBP1-86764] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: FAM83B Antibody [NBP1-86764] - Staining of human skin shows high expression.

Analysis in human cell lines RT-4 and PC-3 using Anti-FAM83B antibody. Corresponding FAM83B RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FAM83B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FAM83B Antibody - BSA Free (NBP1-86764) is a polyclonal antibody validated for use in IHC. Anti-FAM83B Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ALGDRFEGYDNPENLKANALYTHSRLRSSLVFKPTLPEQKEVNSCTTGSSNSTIIGSQGSETPKEVPDTPTNVQHLTDKPLPESIPKLPLQS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FAM83B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: IHC reported in scientific literature (PMID: 25586059). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FAM83B Protein (NBP1-86764PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%). Human reactivity reported in scientific literature (PMID: 25586059).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FAM83B Antibody - BSA Free

• C6orf143
• family with sequence similarity 83, member B
• MGC126677
• MGC138480

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FAM83B Antibody (NBP1-86764)(2)

Publications using NBP1-86764

• Wang J, Li P, Sun L et Al. FAM83B regulates mitochondrial metabolism and anti-apoptotic activity in pulmonary adenocarcinoma Apoptosis 2024-03-13 [PMID: 38478170]
• OKABE N, EZAKI J, YAMAURA T et al. FAM83B is a novel biomarker for diagnosis and prognosis of lung squamous cell carcinoma. Int J Oncol 2015-03-01 [PMID: 25586059] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: FAM83B