FAM82A Antibody


Western Blot: FAM82A Antibody [NBP2-38216] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue
Immunohistochemistry: FAM82A Antibody [NBP2-38216] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

FAM82A Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: SFPVPKAFNTRVEELNLDVLLQKVDHLRMSESGKSESFELLRDHKEKFRDEIEFMWRFARAYGDMYELSTNTQEKK
Specificity of human FAM82A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FAM82A Antibody

  • family with sequence similarity 82, member A1
  • member A
  • UNQ9371/PRO34163


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP, DirELISA
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P

Publications for FAM82A Antibody (NBP2-38216) (0)

There are no publications for FAM82A Antibody (NBP2-38216).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM82A Antibody (NBP2-38216) (0)

There are no reviews for FAM82A Antibody (NBP2-38216). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM82A Antibody (NBP2-38216) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional FAM82A Products

Bioinformatics Tool for FAM82A Antibody (NBP2-38216)

Discover related pathways, diseases and genes to FAM82A Antibody (NBP2-38216). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM82A

There are no specific blogs for FAM82A, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FAM82A Antibody and receive a gift card or discount.


Gene Symbol RMDN2
COVID-19 update