Home » FAM82A » FAM82A Research Products » FAM82A Antibody

FAM82A Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: FAM82A Antibody [NBP2-38216] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue
Western Blot: FAM82A Antibody [NBP2-38216] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue
Immunohistochemistry: FAM82A Antibody [NBP2-38216] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

FAM82A Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: SFPVPKAFNTRVEELNLDVLLQKVDHLRMSESGKSESFELLRDHKEKFRDEIEFMWRFARAYGDMYELSTNTQEKK
Specificity
Specificity of human FAM82A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RMDN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM82A Antibody

  • family with sequence similarity 82, member A1
  • member A
  • UNQ9371/PRO34163

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MD-2 Antibody
NB100-56655
Western Blot: MD-2 Antibody [NB100-56655] - Image of anti-MD2. Total protein from human colon (lane 1) and human spleen (lane 2) was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2 ug/ml anti-MD2 in 1% milk and detected with an anti-rabbit HRP secondary antibody using chemiluminescence.
Immunohistochemistry-Paraffin: MD-2 Antibody [NB100-56655] - Analysis of MD2 in human brain tissue using an isotype control antibody (top left) and MD2 antibody (bottom left, right) at 10 ug/ml.
Immunohistochemistry: MD-2 Antibody [NB100-56655] - Staining of normal human brain using 100-56655 (MD-2)at 10 ug/ml.
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
TLR4 Antibody
(76B357.1)
NB100-56566
Dual RNAscope ISH-IHC: TLR4 Antibody (76B357.1) [NB100-56566] - Formalin-fixed paraffin-embedded tissue sections of human tonsil were probed for TLR4 mRNA (ACD RNAScope Probe, catalog #311281; Fast Red chromogen, ACD catalog # 322750). Adjacent tissue section was processed for immunohistochemistry using Mouse Monoclonal (Novus Biologicals catalog #NB100-56566) at 5ug/mL with 1 hour incubation at room temperature followed by incubation with anti-mouse IgG VisUCyte HRP Polymer Antibody (Catalog # VC001) and DAB chromogen (yellow-brown). Tissue was counterstained with hematoxylin (blue). Specific staining was localized to lymphocytes.
Immunohistochemistry: TLR4 Antibody (76B357.1) [NB100-56566] - Pericryptal Myofibroblasts are Responsible for Increased TLR4 Expression in a Subset of CRCs. Double-stained immunofluorescence for TLR4 (green) and vimentin (red) in normal (I), adenoma (II), and colon adenocarcinoma (III) (10x). In the stromal compartment of CRCs, immunofluorescent staining for TLR4 localized to the pericryptal myofibroblasts in a subset of samples. Image collected and cropped by CiteAb from the following publication (http://www.jeccr.com/content/33/1/45), licensed under a CC-BY licence.
Western Blot: TLR4 Antibody (76B357.1) [NB100-56566] - Analysis using 2 ug/ml on (A) human intestine and 6 ug/ml on (B) mouse intestine and C) rat intestine lysate.
(5 Reviews)
(93 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, Dual ISH-IHC, ELISA(Cap), Flow-CS, Flow-IC, KD, KO
RMD1 Antibody
NBP1-88089
Western Blot: RMD1 Antibody [NBP1-88089] - Analysis in control (vector only transfected HEK293T lysate) and RMDN1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: RMD1 Antibody [NBP1-88089] - Staining of human cell line U-251 MG shows positivity in centrosome.
Immunohistochemistry-Paraffin: RMD1 Antibody [NBP1-88089] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
TLX/NR2E1 Antibody
(H6506)
PP-H6506-00
TLX/NR2E1 Antibody (H6506)
Species: Hu
Applications: WB, IP, DirELISA
RP105/CD180
Antibody
NBP2-20204
Western Blot: RP105 Antibody [NBP2-20204] - Sample (30 ug of whole cell lysate) A: Jurkat 7. 5% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: RP105 Antibody [NBP2-20204] - Immunohistochemical analysis of paraffin-embedded Mahlarvu xenograft, using antibody at 1:500 dilution.
Flow Cytometry: RP105 Antibody [NBP2-20204] - Flow cytometry on Jurkat cells, staining with RP105 antibody at 1:100 dilution (blue) or rabbit IgG (black).
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Cyclin C Antibody
NBP1-18878
Western Blot: Cyclin C Antibody [NBP1-18878] - Whole cell lysate (50 ug) from HeLa, HEK293T, and mouse NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-Cyclin C antibodyused for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3minutes.
Immunohistochemistry-Paraffin: Cyclin C Antibody [NBP1-18878] - Section of human breast carcinoma. Antibody: Affinity purified rabbit anti-Cyclin C used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Western Blot: Cyclin C Antibody [NBP1-18878] - Whole cell lysate (50 ug) from Panc1 (P), 293T (T), Jurkat (J) and H2009 (H) cells for Western Blot. For IP, whole cell lysate (1 mg for IP, 20% of IP loaded) from HeLa cells. NBP1-18878 used for WB at 0.1 ug/ml (A) and 1 ug/ml (B) and used for IP at 3 ug/mg lysate.
Species: Hu
Applications: WB, IHC, IHC-P, IP
MD-1/LY86 Antibody
NB100-56700
Western Blot: MD-1/LY86 Antibody [NB100-56700] - Analysis of MD-1 in Ramos lysate using MD-1 antibody at 2 ug/ml.
Immunohistochemistry-Paraffin: MD-1/LY86 Antibody [NB100-56700] - Analysis of human spleen using MD-1 antibody at 10 ug/ml.
(3 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(1 Publication)
Species: Hu
FOXO3 Antibody
NBP2-16521
Western Blot: FOXO3 Antibody [NBP2-16521] - FoxO3 expression in nuclear and cytosolic fraction of human breast cancer cell line MDA-MB-231. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: FOXO3 Antibody [NBP2-16521] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: FOXO3A stained by FOXO3A antibody [C3], C-term diluted at 1:1000. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: FOXO3 Antibody [NBP2-16521] - Huh-7 xenograft, using FOXO3A antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(4 Reviews)
(4 Publications)
Species: Hu, Mu, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
GUCY2D Antibody
(1E6)
H00003000-M06
Immunocytochemistry/Immunofluorescence: GUCY2D Antibody (1E6) [H00003000-M06] - Analysis of monoclonal antibody to GUCY2D on HeLa cell. Antibody concentration 10 ug/ml
ELISA: GUCY2D Antibody (1E6) [H00003000-M06] - Detection limit for recombinant GST tagged GUCY2D is approximately 3ng/ml as a capture antibody.
ELISA: GUCY2D Antibody (1E6) [H00003000-M06] - Detection limit for recombinant GST tagged GUCY2D is approximately 0.1ng/ml as a capture antibody.
Species: Hu
Applications: WB, ELISA, ICC/IF
NDUFA2 Antibody
NBP1-88968
Western Blot: NDUFA2 Antibody [NBP1-88968] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: NDUFA2 Antibody [NBP1-88968] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
Species: Hu
Applications: WB, IHC, IHC-P
RQCD1 Antibody
NBP1-92354
Immunohistochemistry-Paraffin: RQCD1 Antibody [NBP1-92354] Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P
BLIMP1/PRDM1
Antibody (3H2-E8)
NB600-235
Western Blot: BLIMP1/PRDM1 Antibody (3H2-E8) [NB600-235] - Detection of Blimp-1 in murine plasmacytoma cell lysate (P3X) using NB 600-235. 1881: murine pre-B cell lysate (negative control). Photo courtesy of DA Savitsky, Columbia University.
Immunocytochemistry/Immunofluorescence: BLIMP1/PRDM1 Antibody (3H2-E8) [NB600-235] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-BLIMP1 (3H2-E8) at 10 ug/ml overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: BLIMP1/PRDM1 Antibody (3H2-E8) [NB600-235] - Analysis using paraffin-embedded human tonsil tissue with BLIMP1/PRDM1 antibody at dilution of 1:50. Detection is completed through VC001 (DAB) and Counterstained by hematoxylin; labeling is predominantly in germinal centers. Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(2 Reviews)
(47 Publications)
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(26 Reviews)
(633 Publications)
Species: Hu
NOD2 Antibody (2D9)
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Total protein from human THP1 and US-OS cells and mouse Raw264.7 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-NOD2 in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-NOD2 (2D9) NB100-524 at a 1:200 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was counterstained with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.
(1 Review)
(19 Publications)
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
KAT8 regulatory
NSL3 Antibody
NBP1-83875
Western Blot: KAT8 regulatory NSL3 Antibody [NBP1-83875] - Analysis in human cell line SCLC-21H.
Immunohistochemistry-Paraffin: KAT8 regulatory NSL3 Antibody [NBP1-83875] - Staining of human tonsil shows weak to moderate cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: KAT8 regulatory NSL3 Antibody [NBP1-83875] - Staining of human kidney shows strong positivity in cytoplasm in cells in tubules.
(3 Publications)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Fyn Antibody
(FYN-01)
NB500-517
Immunocytochemistry/Immunofluorescence: Fyn Antibody (FYN-01) [NB500-517] - Staining of Fyn in murine transformed fibroblasts using anti-Fyn (FYN-01; red). Actin cytoskeleton was decorated by phalloidin (green) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: Fyn Antibody (FYN-01) [NB500-517] - Staining of Fyn in human primary fibroblasts using anti-Fyn (FYN-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
Immunocytochemistry/Immunofluorescence: Fyn Antibody (FYN-01) [NB500-517] - Staining of Fyn in human HeLa cell line using anti-Fyn (FYN-01; green). Actin cytoskeleton was decorated by phalloidin (red) and cell nuclei stained with DAPI (blue).
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
FAM82A Antibody
NBP2-38216
FAM82A Antibody
Species: Hu
Applications: WB, IHC, IHC-P

Publications for FAM82A Antibody (NBP2-38216) (0)

There are no publications for FAM82A Antibody (NBP2-38216).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM82A Antibody (NBP2-38216) (0)

There are no reviews for FAM82A Antibody (NBP2-38216). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM82A Antibody (NBP2-38216) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional FAM82A Products

Bioinformatics Tool for FAM82A Antibody (NBP2-38216)

Discover related pathways, diseases and genes to FAM82A Antibody (NBP2-38216). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM82A

There are no specific blogs for FAM82A, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM82A Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol RMDN2
Uniprot
COVID-19 update