FAM82A Antibody

Images

 
Western Blot: FAM82A Antibody [NBP1-87934] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: FAM82A Antibody [NBP1-87934] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: FAM82A Antibody [NBP1-87934] - Staining of human testis shows strong cytoplasmic positivity in leydig cells.
Immunohistochemistry-Paraffin: FAM82A Antibody [NBP1-87934] - Staining of human testis shows strong cytoplasmic positivity in leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM82A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RKPGIAMKLPEFLSLGNTFNSITLQDEIHDDQGTTVIFQERQLQILEKLNELLTNMEELKEEIRFLKEAIPKLEEYIQDELGGKITVHKISPQHR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM82A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM82A Protein (NBP1-87934PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM82A Antibody

  • family with sequence similarity 82, member A1
  • member A
  • UNQ9371/PRO34163

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56655
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP1-88089
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H6506-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-76706
Species: Hu
Applications: WB, ELISA, IB, ICC/IF, IHC, IHC-P
NBP1-18878
Species: Hu
Applications: WB, IHC-P, IP
NB100-56700
Species: Hu, Mu
Applications: WB, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92354
Species: Hu
Applications: IHC, IHC-P
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-83875
Species: Hu
Applications: WB, IHC, IHC-P
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-87934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FAM82A Antibody (NBP1-87934) (0)

There are no publications for FAM82A Antibody (NBP1-87934).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM82A Antibody (NBP1-87934) (0)

There are no reviews for FAM82A Antibody (NBP1-87934). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM82A Antibody (NBP1-87934) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM82A Products

Bioinformatics Tool for FAM82A Antibody (NBP1-87934)

Discover related pathways, diseases and genes to FAM82A Antibody (NBP1-87934). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on FAM82A

There are no specific blogs for FAM82A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM82A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM82A1