FAM82A Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: FAM82A Antibody [NBP1-87934] - Staining of human cell line U-2 OS shows localization to cytosol, the Golgi apparatus & mitotic spindle.

Analysis in human adrenal gland and tonsil tissues using HPA034706 antibody. Corresponding RMDN2 RNA-seq data are presented for the same tissues.

Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.

Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Immunohistochemistry-Paraffin: FAM82A Antibody [NBP1-87934] - Staining of human testis shows strong cytoplasmic positivity in leydig cells.

Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

FAM82A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit FAM82A Antibody - BSA Free (NBP1-87934) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RKPGIAMKLPEFLSLGNTFNSITLQDEIHDDQGTTVIFQERQLQILEKLNELLTNMEELKEEIRFLKEAIPKLEEYIQDELGGKITVHKISPQHR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RMDN2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  FAM82A Protein (NBP1-87934PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for FAM82A Antibody - BSA Free

• family with sequence similarity 82, member A1
• member A
• UNQ9371/PRO34163

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RMDN2