FAM50A Antibody (5F10) - Azide and BSA Free

Western Blot: FAM50A Antibody (5F10) [H00009130-M02] - FAM50A monoclonal antibody (M02), clone 5F10. Analysis of FAM50A expression in PC-12.

Immunohistochemistry-Paraffin: FAM50A Antibody (5F10) [H00009130-M02] - Analysis of monoclonal antibody to FAM50A on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 0.5 ug/ml.

Western Blot: FAM50A Antibody (5F10) [H00009130-M02] - FAM50A monoclonal antibody (M02), clone 5F10 Analysis of FAM50A expression in Hela S3 NE.

Sandwich ELISA: FAM50A Antibody (5F10) [H00009130-M02] - Detection limit for recombinant GST tagged FAM50A is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu, Rt
• Applications: WB, ELISA, IHC
• Clone: 5F10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

FAM50A Antibody (5F10) - Azide and BSA Free Summary

• Immunogen: FAM50A (NP_004690, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALVKEREKQL
• Specificity: FAM50A - family with sequence similarity 50, member A
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: FAM50A
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for ELISA and immunohistochemistry (paraffin).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FAM50A Antibody (5F10) - Azide and BSA Free

• DXS9928EXAP-5 protein
• family with sequence similarity 50, member A
• HXC-26
• Protein HXC-26
• Protein XAP-5
• XAP5HXC26,9F

Background

The FAM50A gene belongs to the FAM50 family. The encoded protein is highly conserved in length and sequence across different species. It is a basic protein containing a nuclear localization signal, and may function as a DNA-binding protein or a transcriptional

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FAM50A
• Entrez:
  • 9130(Human)
• OMIM:
  • 300453(Human)
• Uniprot:
  • NP_004690(Human)