FAM46C Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FAM46C Antibody [NBP2-30564] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: FAM46C Antibody [NBP2-30564] - Staining of human tonsil shows moderate cytoplasmic positivity in subsets of cells.
Immunohistochemistry: FAM46C Antibody [NBP2-30564] - Staining of human lateral ventricle shows moderate cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM46C Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MAEESSCTRDCMSFSVLNWDQVSRLHEVLTEVVPIHGRG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM46C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM46C Protein (NBP2-30564PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM46C Antibody

  • family with sequence similarity 46, member C
  • FLJ20202
  • hypothetical protein LOC54855

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-1244
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-27109
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western, IHC, IHC-P
NB100-594
Species: Hu, Mu, Ca
Applications: WB, IHC-P
NBP2-59942
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF6846
Species: Hu
Applications: IHC
NBP1-89830
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13440
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
H00010581-B01P
Species: Hu
Applications: WB, ELISA
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-29617
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P
7570-GH
Species: Hu
NB100-77314
Species: Hu, Mu
Applications: WB, IP, PLA
NBP2-61159
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-86761
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-91826
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-07321
Species: Hu
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-30564
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for FAM46C Antibody (NBP2-30564) (0)

There are no publications for FAM46C Antibody (NBP2-30564).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM46C Antibody (NBP2-30564) (0)

There are no reviews for FAM46C Antibody (NBP2-30564). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FAM46C Antibody (NBP2-30564) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM46C Products

Bioinformatics Tool for FAM46C Antibody (NBP2-30564)

Discover related pathways, diseases and genes to FAM46C Antibody (NBP2-30564). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM46C Antibody (NBP2-30564)

Discover more about diseases related to FAM46C Antibody (NBP2-30564).

Blogs on FAM46C

There are no specific blogs for FAM46C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM46C Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM46C
Uniprot