FAM129B Antibody

Images

 
Independent Antibodies: Western Blot: FAM129B Antibody [NBP1-88784] - Analysis using Anti-FAM129B antibody NBP1-88784 (A) shows similar pattern to independent antibody NBP1-88783 (B).
Western Blot: FAM129B Antibody [NBP1-88784] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: FAM129B Antibody [NBP1-88784] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, plasma membrane & cytosol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

FAM129B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LIGNSLPGTTAKSGSAPILKCPTQFPLILWHPYARHYYFCMMTEAEQDKWQAVLQDCIRHCNNGIPEDSKVEGPAFTDAIRMYRQSKELYGTWEMLCGNE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NIBAN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry Validated in publication (Cai L, Zhang S, Yang Z et al.)
  • Immunohistochemistry-Frozen Validated in publication (Cai L, Zhang S, Yang Z et al.)
  • Immunohistochemistry-Paraffin Validated in publication (Cai L, Zhang S, Yang Z et al.)
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
FAM129B Protein (NBP1-88784PEP)
Publications
Read Publications using
NBP1-88784 in the following applications:

  • IF
    1 publication
  • IHC
    1 publication
  • 1 publication
  • 1 publication
  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM129B Antibody

  • bA356B19.6
  • C9orf88
  • chromosome 9 open reading frame 88
  • DKFZP434H0820
  • family with sequence similarity 129, member B
  • FLJ13518
  • FLJ22151
  • FLJ22298
  • MEG-3
  • MINERVA
  • niban-like protein 1
  • OC58
  • Protein FAM129B

Background

Niban-like protein (NIBL) is a member of the niban family of proteins and contains a pleckstrin homology (PH) domain which is found in proteins involved in intracellular signaling and cytoskeletal organization. The function of niban and NIBL has not been fully elucidated.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MAB1230
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
NBP1-47668
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-43792
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
NBP1-47833
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-05584
Species: Mu, Rt
Applications: WB
AF1347
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-29373
Species: Hu, Mu, Rt
Applications: Flow-CS, Flow, ICC/IF
NBP2-16182
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NB100-96916
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
H00050848-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, S-ELISA, WB
AF4096
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
AF761
Species: Mu
Applications: AdBlk, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, Simple Western, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NBP1-91499
Species: Bv, Mu
Applications: IHC, IHC-P, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Publications for FAM129B Antibody (NBP1-88784)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 5 applications: IF, IHC, IHC-Fr, IHC-P, WB.


Filter By Application
IF
(1)
IHC
(1)
IHC-Fr
(1)
IHC-P
(1)
WB
(2)
All Applications
Filter By Species
Mouse
(2)
All Species
Showing Publications 1 - 2 of 2.
Publications using NBP1-88784 Applications Species
Zhang S, Yang Z, Wei R et al. NIBAN2 promotes osteogenic differentiation and antagonizes osteoporosis by regulating RUNX2 alternative splicing Research Square 2023-01-04 (IHC, WB, IF, Mouse) IHC, WB, IF Mouse
Cai L, Zhang S, Yang Z et al. Identification of NIBAN2-regulated RUNX2 alternative splicing presents novel strategies antagonizing osteoporosis Research Square 2023-08-30 (IHC-Fr, WB, IHC-P, Mouse) IHC-Fr, WB, IHC-P Mouse

Reviews for FAM129B Antibody (NBP1-88784) (0)

There are no reviews for FAM129B Antibody (NBP1-88784). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FAM129B Antibody (NBP1-88784) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM129B Products

Diseases for FAM129B Antibody (NBP1-88784)

Discover more about diseases related to FAM129B Antibody (NBP1-88784).
 

Pathways for FAM129B Antibody (NBP1-88784)

View related products by pathway.

PTMs for FAM129B Antibody (NBP1-88784)

Learn more about PTMs related to FAM129B Antibody (NBP1-88784).
 

Research Areas for FAM129B Antibody (NBP1-88784)

Find related products by research area.

Blogs on FAM129B

There are no specific blogs for FAM129B, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM129B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NIBAN2