FAM129B Antibody

Images

 
Western Blot: FAM129B Antibody [NBP1-88783] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: FAM129B Antibody [NBP1-88783] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM129B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LSNLVMEELGPELKAELGPRLKGKPQERQRQWIQISDAVYHMVYEQAKARFEEVLSKVQQVQPAMQAVIRTDMDQIITSKEHLASKIRAFILPKAEVCVRNHV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM129B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAM129B Protein (NBP1-88783PEP)
Publications
Read Publication using NBP1-88783.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%). Reactivity reported in scientific literature (PMID: 24358901)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM129B Antibody

  • bA356B19.6
  • C9orf88
  • chromosome 9 open reading frame 88
  • DKFZP434H0820
  • family with sequence similarity 129, member B
  • FLJ13518
  • FLJ22151
  • FLJ22298
  • MEG-3
  • MINERVA
  • niban-like protein 1
  • OC58
  • Protein FAM129B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-43792
Species: Hu
Applications: WB
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005545-R02
Species: Hu
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF1239
Species: Mu
Applications: WB, IHC, IP
AF1103
Species: Hu
Applications: WB, IHC, ICC
AF4096
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF761
Species: Mu
Applications: WB, Simple Western, Flow, IHC, AdBlk, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-88783
Species: Hu
Applications: WB, IHC, IHC-P

Publications for FAM129B Antibody (NBP1-88783)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for FAM129B Antibody (NBP1-88783) (0)

There are no reviews for FAM129B Antibody (NBP1-88783). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM129B Antibody (NBP1-88783) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM129B Products

Bioinformatics Tool for FAM129B Antibody (NBP1-88783)

Discover related pathways, diseases and genes to FAM129B Antibody (NBP1-88783). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM129B Antibody (NBP1-88783)

Discover more about diseases related to FAM129B Antibody (NBP1-88783).
 

Pathways for FAM129B Antibody (NBP1-88783)

View related products by pathway.

PTMs for FAM129B Antibody (NBP1-88783)

Learn more about PTMs related to FAM129B Antibody (NBP1-88783).

Blogs on FAM129B

There are no specific blogs for FAM129B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM129B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM129B