Home » FAIM1 » FAIM1 Proteins » FAIM1 Recombinant Protein Antigen

FAIM1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for FAIM1 Recombinant Protein Antigen (NBP2-48764PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

FAIM1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FAIM1.

Source: E. coli

Amino Acid Sequence: MLLPFIRTLPLLCYNHLLVSPDSATLSPPYSLEKMTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGK
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FAIM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-48764.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for FAIM1 Recombinant Protein Antigen

  • FAIM1FLJ10582
  • fas apoptotic inhibitory molecule 1
  • Fas apoptotic inhibitory molecule

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

FLIP Antibody
NB100-56141
Western Blot: FLIP Antibody [NB100-56141] - analysis of FLIP in human ovarian cancer cell lines using anti-FLIP antibody. The primary antibody was used at a dilution of 1:200 and incubated for overnight at 4C in 5% milk in PBST. Image from verified customer review.
Immunohistochemistry: FLIP Antibody [NB100-56141] - Immunhohistochemical analysis of FLIP in tissues cores from a formalin-fixed, paraffin-embedded human brain tumor microarray using NB100-56141 at 1:2000. A-C, tissue cores from a patient with gemistocytoma. A, normal adjacent brain tissue. Astrocytes are positive for Flip expression. B, gemistocytoma (Grade II). Gemistocytes are positive for Flip expression. C, peritumoural oedma brain tissue. Reactive astrocytocytes are positive for FLIP expression. C1, a higher magnification of C. Collectively, the data shows that astrocytes (normal), reactive astrocytes and gemistocytes are positive for Flip expression. Hematoxylin-eosin counterstain.
Immunohistochemistry: FLIP Antibody [NB100-56141] - Immunhohistochemical analysis of FLIP in two tissues cores from a formalin-fixed, paraffin-embedded human brain tumor microarray using NB100-56141 at 1:2000. A, gemistocytoma (Grade II) positive for FLIP expression. B, gemistocytoma (Grade II) negative for FLIP expression. A1 and A2 are higher magnifications from A. A, A1, and A2 show expression of FLIP in the gemistocytes of the tumor. Hematoxylin-eosin counterstain.
(1 Review)
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Fas/TNFRSF6/CD95
Antibody
NB120-13550
Western Blot: Fas/TNFRSF6/CD95 Antibody [NB120-13550] - FAS Western blot for whole cell lysate from mouse testis.
Immunohistochemistry-Paraffin: Fas/TNFRSF6/CD95 Antibody [NB120-13550] - Staining of human hepatoma tissue with Fas polyclonal antibody.
Western Blot: Fas/TNFRSF6/CD95 Antibody [NB120-13550] - Analysis of mouse testis tissue extractm probed with Fas polyclonal antibody.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Caspase-8 Antibody
- (active/cleaved)
NB100-56116
Western Blot: Caspase-8 Antibody - (active/cleaved) [NB100-56116] - Analysis of active/cleaved Caspase 8 in NRK whole cell lysate using anti-active/cleaved Caspase 8 antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Caspase-8 Antibody - (active/cleaved) [NB100-56116] - Sections from a brain tissue array stained for Caspase-8 expression using NB100-56116 at 1:2000. A. Normal brain stem (1) and cortex (2). B. Higher magnification of cortex (from A). C. Higher magnification of brain stem (from A). D. Normal cerebellum showing caspase-8 staining in the Purkinge cells.
Immunohistochemistry-Paraffin: Caspase-8 Antibody - (active/cleaved) [NB100-56116] - Sections from a brain tumor tissue array stained for Caspase-8 expression using NB100-56116 at 1:2000. A. Anaplastic glioma (Grade III, left) and Gemistocytoma (Grade II, right) cores showing negative and positive staining for Caspase-8, respectively. B. Higher magnification of the Gemistocytoma tumor (from A).
(1 Review)
(38 Publications)
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
bcl-x Antibody
[Unconjugated]
AF800
Western blot shows lysates of A431 human epithelial carcinoma cell line (5 x 104 cells, lane 1 and 2.5 x 104 cells, lane 2) and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 0.3 µg/mL of Rabbit Anti-Human Bcl‑x Antigen Affinity-purified Polyclonal Antibody (Catalog # AF800) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Bcl‑x at approximately 26 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Bcl-x was immunoprecipitated from lysates (7 x 105 cells) of A431 human epithelial carcinoma cell line following incubation with 3 µg Rabbit Anti-Human Bcl‑x Antigen Affinity-purified Polyclonal Antibody (Catalog # AF800) for 30‑60 minutes at 4 °C. Bcl-x-antibody complexes were absorbed using Protein A Immunoprecipitin (Life Technologies). Immuno­precipitated Bcl-x was detected by Western blot using 0.3 µg/mL Rabbit Anti-Human Bcl‑x Antigen Affinity-purified Polyclonal Antibody (Catalog # AF800). View our recommended buffer recipes for immunoprecipitation.
Simple Western lane view shows lysates of A431 human epithelial carcinoma cell line and NIH‑3T3 mouse embryonic fibroblast cell line, loaded at 0.2 mg/mL. A specific band was detected for Bcl‑x at approximately 34 kDa (as indicated) using 3 µg/mL of Rabbit Anti-Human/Mouse Bcl‑x Antigen Affinity-purified Polyclonal Antibody (Catalog # AF800). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(1 Review)
(6 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, IP
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(21 Reviews)
(526 Publications)
Species: Hu
IRF4 Antibody
AF5525
Western blot shows lysates of Ramos human Burkitt's lymphoma cell line, Raji human Burkitt's lymphoma cell line, and RPMI 8226 human multiple myeloma cell line. PVDF membrane was probed with 0.5 µg/mL of Sheep Anti-Human IRF4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5525) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for IRF4 at approximately 53 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
IRF4 was detected in immersion fixed paraffin-embedded sections of human tonsil using Sheep Anti-Human IRF4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5525) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm of lymphocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, IHC
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse DyLight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase‑3 was detected in immersion fixed paraffin-embedded sections of human colon cancer tissue using Rabbit Anti-Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Rabbit IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC003). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
Caspase‑3 was detected in immersion fixed Jurkat human acute T cell leukemia cell line stimulated with staurosporin using Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (yellow; Catalog # NL004) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(9 Reviews)
(135 Publications)
Species: Hu, Mu
Applications: IHC, ICC
XIAP Antibody
[Unconjugated]
AF8221
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, C2C12 mouse myoblast cell line, and PC‑12 rat adrenal pheochromocytoma cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat XIAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8221) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for XIAP at approximately 56 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line and C2C12 mouse myoblast cell line, loaded at 0.2 mg/mL. A specific band was detected for XIAP at approximately 59 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse/Rat XIAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8221) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
XIAP was detected in immersion fixed paraffin-embedded sections of human lymphoma using 5 µg/mL Goat Anti-Human/Mouse/Rat XIAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8221) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(13 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
Fas Ligand/TNFSF6
Antibody (100419)
MAB126
In the presence of a cross-linking antibody, Mouse polyHistidine Monoclonal Antibody (Catalog # MAB050), Recombinant Human Fas Ligand/TNFSF6 (Catalog # 126-FL) induces cytotoxicity in the Jurkat human acute T cell leukemia cell line in a dose-dependent manner (orange line). Under these conditions, cytotoxicity elicited by Recombinant Human Fas Ligand/TNFSF6 (2 ng/mL) is neutralized (green line) by increasing concentrations of Human Fas Ligand/TNFSF6 Monoclonal Antibody (Catalog # MAB126). The ND50 is typically 1-5 ng/mL.
(2 Reviews)
(12 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Caspase-9 Antibody
NB100-56118
Immunohistochemistry-Paraffin: Caspase-9 Antibody [NB100-56118] - Analysis Human Brain sections stained for cleaved Caspase-9 expression using this antibody at 1:2000. A. Section from a patient 24 hr after head trauma. B. Control: section from a patient with no known neurological disease or head injury. Hematoxylin-eosin counterstain.
Immunohistochemistry-Paraffin: Caspase-9 Antibody [NB100-56118] - Analysis of Capase-9 in mouse transplanted lung tumor section using anti-Caspase-9 antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Caspase-9 Antibody [NB100-56118] - Analysis of Dog Brain sections stained for Active/Cleaved Caspase-9 expression at 1:2000. A and B. The pattern of Caspase-9 staining may vary between different types of neurons. Hematoxylin-eosin counterstain.
(1 Review)
(15 Publications)
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
FADD [p Ser194]
Antibody (709736)
MAB7047
Western blot shows lysates of HT‑29 human colon adenocarcinoma cell line and HeLa human cervical epithelial carcinoma cell line untreated (-) or treated (+) with 1 µg/mL nocodazole or 4 mM hydroxyurea for 20 hours. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human Phospho-FADD (S194) Monoclonal Antibody (Catalog # MAB7047) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for FADD at approximately 28 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
FADD phosphorylated at S194 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line stimulated with nocadazole using Mouse Anti-Human Phospho-FADD (S194) Monoclonal Antibody (Catalog # MAB7047) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: WB, ICC
BID Antibody
[Unconjugated]
AF860
Western blot shows Jurkat human acute T cell leukemia cell line treated with apoptosis inducer anti-Fas for the indicated times. PVDF membrane was probed with 1 µg/mL Goat Anti-Human/Mouse BID Antigen Affinity-purified Polyclonal Antibody (Catalog # AF860) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for BID at approximately 20 kDa (as indicated). For additional reference short (5 seconds, left panel) and long (60 seconds, right panel) exposures are shown. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 2.
Simple Western lane view shows lysates of Jurkat human acute T cell leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for BID at approximately 29 kDa (as indicated) using 10 µg/mL of Goat Anti-Human/Mouse BID Antigen Affinity-purified Polyclonal Antibody (Catalog # AF860) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of SVEC4‑10 mouse vascular endothelial cell line and Jurkat human acute T cell leukemia cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse BID Antigen Affinity-purified Polyclonal Antibody (Catalog # AF860) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for BID at approximately 20 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(15 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, IP
PDCD6 Antibody
NBP2-19741
Western Blot: PDCD6 Antibody [NBP2-19741] - Sample (30 ug of whole cell lysate) A: HeLa nucleus 12% SDS PAGE gel, diluted at 1:500.
Immunocytochemistry/Immunofluorescence: PDCD6 Antibody [NBP2-19741] - Confocal immunofluorescence analysis of paraformaldehyde-fixed HeLa, using PDCD6 antibody (Green) at 1:500 dilution. Alpha-tubulin filaments are labeled with Alpha-tubulin antibody (Red) at 1:2000.
Immunohistochemistry-Paraffin: PDCD6 Antibody [NBP2-19741] - Paraffin-embedded human colon carcinoma. PDCD6 antibody diluted at 1:500.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
APAF-1 Antibody
NB100-56074
Western Blot: APAF1 Antibody [NB100-56074] - Analysis of Apaf 1 using this antibody. Jurkat: human T-cell leukemia cell line lysate. RS11-846: human B-cell leukemia cell line lysate. Human thymus: tissue lysate.
Immunocytochemistry/Immunofluorescence: APAF1 Antibody [NB100-56074] - Formalin-fixed, paraffin-embedded sections from a human brain tumor tissue microarray stained for Apaf 1 expression using NB100-56074 at 1:2000. A and B. Tissue microarray overview. A1 and B1, higher magnification of cores from A and B, respectively. Differential expression of Apaf 1 is seen between patient samples. Hematoxylin-eosin counterstain.
Immunohistochemistry: APAF-1 Antibody [NB100-56074] - APAF1 Antibody [NB100-56074] - Formalin-fixed, paraffin-embedded tissue sections of human brain tumors stained for Apaf 1 expression using NB100-56074 at 1:2000. A. Gemistocytoma (grade II). B. Anaplastic glioma. A high level of Apaf 1 was observed in the gemistocytoma whereas a low level was seen in the more malignant anaplastic glioma. Hematoxylin-eosin counterstain.
(1 Publication)
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NFkB p105/p50
Antibody (2J10D7)
NB100-56583
Western Blot: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - Analysis of p50 in HeLa lysate in the A) absence and B) presence of immunizing peptide using p50 antibody at 5 ug/ml.
Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - IHC-P of rabbit aorta using NB100-56583. Secondary antibody: anti-mouse histofine ( Nisherei Bioscience Inc. ref: 414131F). Development: DAB (Dako ref: K346811-2) and counterstained with Hematoxylin. Submitted via verified customer review
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on U937 cells with NFkB p105/p50 [2J10D7] Antibody NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 650.
(1 Review)
(1 Publication)
Species: Hu, Rb
Applications: WB, Flow, IHC-P
Bax Antibody (6A7)
NBP1-28566
Western Blot: Bax Antibody (6A7) [NBP1-28566] - Total cell lysates from NIH/3T3 cells were resolved by electrophoresis, transferred to PVDF membrane, and probled with Mouse Anti-Bax UNLB.
Immunohistochemistry-Frozen: Bax Antibody (6A7) [NBP1-28566] - Mouse retina with no pretreatment
Western Blot: Bax Antibody (6A7) [NBP1-28566] - Analysis of lysates from human metastatic pancreatic cancer cell line L3.6pl using Bax Antibody (clone 6A7; Lot # B168-P780E). This image was submitted via reviews by a varified end user.
(3 Reviews)
(4 Publications)
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
FAIM1 Recombinant
Protein Antigen
NBP2-48764PEP
FAIM1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for FAIM1 Recombinant Protein Antigen (NBP2-48764PEP) (0)

There are no publications for FAIM1 Recombinant Protein Antigen (NBP2-48764PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAIM1 Recombinant Protein Antigen (NBP2-48764PEP) (0)

There are no reviews for FAIM1 Recombinant Protein Antigen (NBP2-48764PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for FAIM1 Recombinant Protein Antigen (NBP2-48764PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for FAIM1 Recombinant Protein Antigen (NBP2-48764PEP)

Discover related pathways, diseases and genes to FAIM1 Recombinant Protein Antigen (NBP2-48764PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAIM1 Recombinant Protein Antigen (NBP2-48764PEP)

Discover more about diseases related to FAIM1 Recombinant Protein Antigen (NBP2-48764PEP).
 

Pathways for FAIM1 Recombinant Protein Antigen (NBP2-48764PEP)

View related products by pathway.

PTMs for FAIM1 Recombinant Protein Antigen (NBP2-48764PEP)

Learn more about PTMs related to FAIM1 Recombinant Protein Antigen (NBP2-48764PEP).
 

Research Areas for FAIM1 Recombinant Protein Antigen (NBP2-48764PEP)

Find related products by research area.

Blogs on FAIM1

There are no specific blogs for FAIM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FAIM1 Recombinant Protein Antigen
NBP2-47463PEP
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
TNF-alpha [Unconjugated]
210-TA-005
Western Blot: FAIM1 Antibody [NB100-77331] - Analysis of FAIM1 using NB100-77331 at 0.5ug/ml in Human Lymph Node lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
FAIM1 Antibody
NB100-77331
Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase-3 Antibody [Unconjugated] - Active
AF835

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FAIM1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol FAIM