Home » FAIM1 » FAIM1 Proteins » FAIM1 Recombinant Protein Antigen

FAIM1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for FAIM1 Recombinant Protein Antigen (NBP2-48764PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

FAIM1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FAIM1.

Source: E. coli

Amino Acid Sequence: MLLPFIRTLPLLCYNHLLVSPDSATLSPPYSLEKMTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGK
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FAIM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-48764.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for FAIM1 Recombinant Protein Antigen

  • FAIM1FLJ10582
  • fas apoptotic inhibitory molecule 1
  • Fas apoptotic inhibitory molecule

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

FLIP Antibody
NB100-56141
Western Blot: FLIP Antibody [NB100-56141] - analysis of FLIP in human ovarian cancer cell lines using anti-FLIP antibody. The primary antibody was used at a dilution of 1:200 and incubated for overnight at 4C in 5% milk in PBST. Image from verified customer review.
Immunohistochemistry: FLIP Antibody [NB100-56141] - Immunhohistochemical analysis of FLIP in tissues cores from a formalin-fixed, paraffin-embedded human brain tumor microarray using NB100-56141 at 1:2000. A-C, tissue cores from a patient with gemistocytoma. A, normal adjacent brain tissue. Astrocytes are positive for Flip expression. B, gemistocytoma (Grade II). Gemistocytes are positive for Flip expression. C, peritumoural oedma brain tissue. Reactive astrocytocytes are positive for FLIP expression. C1, a higher magnification of C. Collectively, the data shows that astrocytes (normal), reactive astrocytes and gemistocytes are positive for Flip expression. Hematoxylin-eosin counterstain.
Immunohistochemistry: FLIP Antibody [NB100-56141] - Immunhohistochemical analysis of FLIP in two tissues cores from a formalin-fixed, paraffin-embedded human brain tumor microarray using NB100-56141 at 1:2000. A, gemistocytoma (Grade II) positive for FLIP expression. B, gemistocytoma (Grade II) negative for FLIP expression. A1 and A2 are higher magnifications from A. A, A1, and A2 show expression of FLIP in the gemistocytes of the tumor. Hematoxylin-eosin counterstain.
(1 Review)
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Fas/TNFRSF6/CD95
Antibody
NB120-13550
Western Blot: Fas/TNFRSF6/CD95 Antibody [NB120-13550] - FAS Western blot for whole cell lysate from mouse testis.
Immunohistochemistry-Paraffin: Fas/TNFRSF6/CD95 Antibody [NB120-13550] - Staining of human hepatoma tissue with Fas polyclonal antibody.
Western Blot: Fas/TNFRSF6/CD95 Antibody [NB120-13550] - Analysis of mouse testis tissue extractm probed with Fas polyclonal antibody.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Caspase-8 Antibody
- (active/cleaved)
NB100-56116
Western Blot: active/cleaved Caspase 8 Antibody [NB100-56116] - Analysis of active/cleaved Caspase 8 in NRK whole cell lysate using anti-active/cleaved Caspase 8 antibody. Image from verified customer review.
Immunohistochemistry: active/cleaved Caspase 8 Antibody [NB100-56116] - Formalin-fixed, paraffin-embedded sections from a brain tissue array stained for Caspase-8 expression using NB100-56116 at 1:2000. A. Normal brain stem (1) and cortex (2). B. Higher magnification of cortex (from A). C. Higher magnification of brain stem (from A). D. Normal cerebellum showing caspase-8 staining in the Purkinge cells.
Immunohistochemistry: active/cleaved Caspase 8 Antibody [NB100-56116] - Formalin-fixed, paraffin-embedded sections from a brain tumor tissue array stained for Caspase-8 expression using NB100-56116 at 1:2000. A. Anaplastic glioma (Grade III, left) and Gemistocytoma (Grade II, right) cores showing negative and positive staining for Caspase-8, respectively. B. Higher magnification of the Gemistocytoma tumor (from A).
(1 Review)
(36 Publications)
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Bcl-xL Antibody
NB100-56104
Western Blot: Bcl-xL Antibody [NB100-56104] - Analysis of Bcl-xL in Daoy whole cell lysate using anti-Bcl-xL antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Bcl-Xl Antibody [NB100-56104] - Formalin-fixed paraffin-embedded sections of human epidermis stained for Bcl-X expression using this antibody at the bottom of the images were negative for Bcl-X expression. The adjacent stratum spinosum and middle stratum granulosum layers were both very positive for Bcl-X expression. The top stratum corneum consisting mainly of dead or peeling cells were both negative for Bcl-X expression.
Western Blot: Bcl-Xl Antibody [NB100-56104] - Analysis of Bcl-X in lysates from isolated rat liver mitochondria using this antibody. The antibody detected Bcl-XL at ~30 kDa.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
TNF-alpha
[Unconjugated]
210-TA
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(19 Reviews)
(506 Publications)
Species: Hu
IRF4 Antibody
AF5525
Western blot shows lysates of Ramos human Burkitt's lymphoma cell line, Raji human Burkitt's lymphoma cell line, and RPMI 8226 human multiple myeloma cell line. PVDF membrane was probed with 0.5 µg/mL of Sheep Anti-Human IRF4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5525) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for IRF4 at approximately 53 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
IRF4 was detected in immersion fixed paraffin-embedded sections of human tonsil using Sheep Anti-Human IRF4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5525) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm of lymphocytes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, IHC
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - WB analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-p53 (PAb 240) [NB200-103] at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue).Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(2 Reviews)
(22 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Caspase-3 Antibody
(31A1067) - (Pro and ...
NB100-56708
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Analysis using the Azide Free version of NB100-56708. Detection of Caspase-3 activation in HeLa cells. Cells were treated with 2mM staurosporine for different time periods. Caspase-3 activation is determined by cleavage of procaspase-3.
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Western Blot Image of anti-Caspase 3 (31A1067). Whole cell protein from Jurkat cells treated with and without 2 uM staurosporine as indicated was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 5 ug/ml anti-Caspase 3 in 1% milk, and detected with an anti-mouse HRP secondary antibody using a Femto sensitivity chemiluminescence reagent. Note the detection of both pro-caspase 3 at 35 kDa and the cleaved active caspase 3 at 15-17 kDa.
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Analysis using the Azide Free version of NB100-56708. Detection of Caspase-3 in multiple human tissues. The tissues shown are A) brain, B) heart, C) intestine, D) kidney, E) liver, F) lung, G) muscle, H) stomach, I) spleen, J) ovary, and K) testis.
(1 Review)
(113 Publications)
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
XIAP Antibody
[Unconjugated]
AF8221
Western blot shows lysates of Jurkat human acute T cell leukemia cell line, C2C12 mouse myoblast cell line, and PC‑12 rat adrenal pheochromocytoma cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat XIAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8221) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for XIAP at approximately 56 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
XIAP was detected in immersion fixed paraffin-embedded sections of human lymphoma using 5 µg/mL Goat Anti-Human/Mouse/Rat XIAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8221) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
XIAP was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using 15 µg/mL Goat Anti-Human/Mouse/Rat XIAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8221) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(13 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
Fas Ligand/TNFSF6
126-FL/CF
Fas Ligand/TNFSF6
(14 Publications)
Species: Hu
Caspase-9 Antibody
NB100-56118
Immunohistochemistry-Paraffin: Caspase-9 Antibody [NB100-56118] - Analysis Human Brain sections stained for cleaved Caspase-9 expression using this antibody at 1:2000. A. Section from a patient 24 hr after head trauma. B. Control: section from a patient with no known neurological disease or head injury. Hematoxylin-eosin counterstain.
Immunohistochemistry-Paraffin: Caspase-9 Antibody [NB100-56118] - Analysis of Capase-9 in mouse transplanted lung tumor section using anti-Caspase-9 antibody. Image from verified customer review.
Immunohistochemistry-Paraffin: Caspase-9 Antibody [NB100-56118] - Analysis of Dog Brain sections stained for Active/Cleaved Caspase-9 expression at 1:2000. A and B. The pattern of Caspase-9 staining may vary between different types of neurons. Hematoxylin-eosin counterstain.
(1 Review)
(15 Publications)
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
FADD Antibody
NBP1-81831
Western Blot: FADD Antibody [NBP1-81831] - Analysis in human cell lines A-431 and HeLa using Anti-FADD antibody. Corresponding FADD RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Immunocytochemistry/Immunofluorescence: FADD Antibody [NBP1-81831] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: FADD Antibody [NBP1-81831] - Staining of human gallbladder shows cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
BID Antibody
NB100-56106
Western Blot: BID Antibody [NB100-56106] - Analysis of Bid in normal mouse tissues using this antibody. BID = recombinant Bid. Arrowheads indicate the positions of the full-length (uncleaved) ~22 kDa Bid and the ~15 kDa truncated form of Bid (tBid) typical of the caspase-cleavage. Additional bands representing partial Bid degradation products are indicated by asterisks (*).
Immunohistochemistry-Paraffin: BID Antibody [NB100-56106] - Two cores from a human ovarian carcinoma formalin-fixed, paraffin-embedded tissue microarray demonstrate the variable expression of Bid protein. The sections were stained with Bid antibody at 1:2000 with hematoxylin-eosin counterstain. Section A shows very weak staining while section B stains much more strongly.
Western Blot: BID Antibody [NB100-56106] - Analysis of BID in NRK whole cell lysate using anti-BID antibody. Image from verified customer review.
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
PDCD6 Antibody
NBP2-19741
Western Blot: PDCD6 Antibody [NBP2-19741] - Sample (30 ug of whole cell lysate) A: HeLa nucleus 12% SDS PAGE gel, diluted at 1:500.
Immunocytochemistry/Immunofluorescence: PDCD6 Antibody [NBP2-19741] - Confocal immunofluorescence analysis of paraformaldehyde-fixed HeLa, using PDCD6 antibody (Green) at 1:500 dilution. Alpha-tubulin filaments are labeled with Alpha-tubulin antibody (Red) at 1:2000.
Immunohistochemistry-Paraffin: PDCD6 Antibody [NBP2-19741] - Paraffin-embedded human colon carcinoma. PDCD6 antibody diluted at 1:500.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
APAF-1 Antibody
NB100-56074
Western Blot: APAF1 Antibody [NB100-56074] - Analysis of Apaf 1 using this antibody. Jurkat: human T-cell leukemia cell line lysate. RS11-846: human B-cell leukemia cell line lysate. Human thymus: tissue lysate.
Immunocytochemistry/Immunofluorescence: APAF1 Antibody [NB100-56074] - Formalin-fixed, paraffin-embedded sections from a human brain tumor tissue microarray stained for Apaf 1 expression using NB100-56074 at 1:2000. A and B. Tissue microarray overview. A1 and B1, higher magnification of cores from A and B, respectively. Differential expression of Apaf 1 is seen between patient samples. Hematoxylin-eosin counterstain.
Immunohistochemistry: APAF-1 Antibody [NB100-56074] - APAF1 Antibody [NB100-56074] - Formalin-fixed, paraffin-embedded tissue sections of human brain tumors stained for Apaf 1 expression using NB100-56074 at 1:2000. A. Gemistocytoma (grade II). B. Anaplastic glioma. A high level of Apaf 1 was observed in the gemistocytoma whereas a low level was seen in the more malignant anaplastic glioma. Hematoxylin-eosin counterstain.
(1 Publication)
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NFkB p105/p50
Antibody (2J10D7)
NB100-56583
Western Blot: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - analysis of p50 in HeLa lysate in the A) absence and B) presence of immunizing peptide using p50 antibody at 5 ug/ml.
Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - analysis of human breast tumor tissue using an isotype control antibody (top) and p50 antibody (bottom) at 5 ug/ml.
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on Jurkat cells with NFkB p105/p50 Antibody (2J10D7) NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes. Both antibodies were conjugated to Dylight 650.
(1 Review)
(1 Publication)
Species: Hu
Applications: WB, Flow, IHC-P
Bax Antibody (6A7)
NBP1-28566
Western Blot: Bax Antibody (6A7) [NBP1-28566] - Total cell lysates from NIH/3T3 cells were resolved by electrophoresis, transferred to PVDF membrane, and probled with Mouse Anti-Bax UNLB.
Immunohistochemistry-Frozen: Bax Antibody (6A7) [NBP1-28566] - Mouse retina with no pretreatment
Western Blot: Bax Antibody (6A7) [NBP1-28566] - Analysis of lysates from human metastatic pancreatic cancer cell line L3.6pl using Bax Antibody (clone 6A7; Lot # B168-P780E). This image was submitted via reviews by a varified end user.
(3 Reviews)
(3 Publications)
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
FAIM1 Recombinant
Protein Antigen
NBP2-48764PEP
FAIM1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for FAIM1 Recombinant Protein Antigen (NBP2-48764PEP) (0)

There are no publications for FAIM1 Recombinant Protein Antigen (NBP2-48764PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAIM1 Recombinant Protein Antigen (NBP2-48764PEP) (0)

There are no reviews for FAIM1 Recombinant Protein Antigen (NBP2-48764PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for FAIM1 Recombinant Protein Antigen (NBP2-48764PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for FAIM1 Recombinant Protein Antigen (NBP2-48764PEP)

Discover related pathways, diseases and genes to FAIM1 Recombinant Protein Antigen (NBP2-48764PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAIM1 Recombinant Protein Antigen (NBP2-48764PEP)

Discover more about diseases related to FAIM1 Recombinant Protein Antigen (NBP2-48764PEP).
 

Pathways for FAIM1 Recombinant Protein Antigen (NBP2-48764PEP)

View related products by pathway.

PTMs for FAIM1 Recombinant Protein Antigen (NBP2-48764PEP)

Learn more about PTMs related to FAIM1 Recombinant Protein Antigen (NBP2-48764PEP).
 

Research Areas for FAIM1 Recombinant Protein Antigen (NBP2-48764PEP)

Find related products by research area.

Blogs on FAIM1

There are no specific blogs for FAIM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FAIM1 Recombinant Protein Antigen
NBP2-47463PEP
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
TNF-alpha [Unconjugated]
210-TA-005
Western Blot: FAIM1 Antibody [NB100-77331] - Analysis of FAIM1 using NB100-77331 at 0.5ug/ml in Human Lymph Node lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
FAIM1 Antibody
NB100-77331
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Analysis using the Azide Free version of NB100-56708. Detection of Caspase-3 activation in HeLa cells. Cells were treated with 2mM staurosporine for different time periods. Caspase-3 activation is determined by cleavage of procaspase-3.
Caspase-3 Antibody (31A1067) - (Pro and Active)
NB100-56708

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FAIM1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol FAIM