FADD Recombinant Protein Antigen

Images

 
There are currently no images for FADD Protein (NBP1-81831PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

FADD Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FADD.

Source: E. coli

Amino Acid Sequence: LTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FADD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81831.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for FADD Recombinant Protein Antigen

  • FADD
  • Fas (TNFRSF6)-associated via death domain
  • FAS-associated death domain protein
  • FAS-associating death domain-containing protein
  • GIG3
  • Growth-inhibiting gene 3 protein
  • Mediator of receptor induced toxicity
  • mediator of receptor-induced toxicity
  • MGC8528
  • MORT1
  • MORT1Fas-associating protein with death domain
  • protein FADD

Background

Fas-associating protein with death domain (FADD) is an adaptor protein involved in the apoptosis induced by Fas and TNF-R1, and mitogen induced cell proliferation (1). FADD consists of death domain (DD) at the C-terminal and death effector domain (DED) at the N-terminal (2). DD interacts with Fas and TNF-R1, which exposes the DED portion on the FADD. Unmasked DED binds to the DED of pro-caspase-8, which activates the cysteine protease cascade (3). The development of autoimmune lymphoproliferative (lpr) diseases has been linked to inactivation of Fas-FADD interaction (4). Also, the deficiency in FADD can inhibit TRAIL-induced cell apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB120-13550
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
375-TL
Species: Hu
Applications: BA
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
DFL00B
Species: Hu
Applications: ELISA
NBP1-77077
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-56618
Species: Hu, Mu
Applications: Flow-CS, Flow, ICC/IF, IHC,  IHC-P, WB
AF347
Species: Hu
Applications: IHC, Neut, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF860
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP1-81831PEP
Species: Hu
Applications: AC

Publications for FADD Protein (NBP1-81831PEP) (0)

There are no publications for FADD Protein (NBP1-81831PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FADD Protein (NBP1-81831PEP) (0)

There are no reviews for FADD Protein (NBP1-81831PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FADD Protein (NBP1-81831PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FADD Products

Research Areas for FADD Protein (NBP1-81831PEP)

Find related products by research area.

Blogs on FADD.

Apoptosis and Necroptosis Part II: Inhibitors of apoptosis proteins (IAPs); Key regulators of the balance between necroptosis, apoptosis and survival
In the first installment of this two-part blog post titled "Apoptosis and Necroptosis: Important factors to identify both types of programmed cell death", the mechanisms by which cell death occurs and ways to identify these pathways were ...  Read full blog post.

Apoptosis and Necroptosis Part I: Important factors to identify both types of programmed cell death
Different types of cell death have classically been identified by discrete morphological changes. The hallmarks of apoptosis include cell shrinkage, nuclear fragmentation and membrane blebbing whereas necroptosis is characterized by cell swelling ...  Read full blog post.

FADD - important initiator of death receptor-mediated apoptosis
FAS-associated death domain protein (FADD) is a 23 kDa adaptor protein involved in initiating apoptosis. FADD is best known for its involvement in extrinsic/death receptor-mediated apoptosis, but it is also involved in initiating necroptosis with ...  Read full blog post.

Caspase 9: The Suicidal Cell Whisperer
Cell death via apoptosis is a key cellular function triggered by the cell death receptor family and their ligands which signal through downstream adaptor molecules and the caspase protease family. Among the subclass of initiator caspases that include ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our FADD Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FADD