FADD Antibody (1E8.)

Images

 
ELISA: FADD Antibody (1E8) [H00008772-M04] - Detection limit for recombinant GST tagged FADD is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1E8.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FADD Antibody (1E8.) Summary

Immunogen
FADD (AAH00334, 109 a.a. - 208 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS
Specificity
FADD - Fas (TNFRSF6)-associated via death domain (1E8)
Isotype
IgG1 Lambda
Clonality
Monoclonal
Host
Mouse
Gene
FADD
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FADD Antibody (1E8.)

  • FADD
  • Fas (TNFRSF6)-associated via death domain
  • FAS-associated death domain protein
  • FAS-associating death domain-containing protein
  • GIG3
  • Growth-inhibiting gene 3 protein
  • Mediator of receptor induced toxicity
  • mediator of receptor-induced toxicity
  • MGC8528
  • MORT1
  • MORT1Fas-associating protein with death domain
  • protein FADD

Background

The protein encoded by this gene is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. Through its C-terminal death domain, this protein can be recruited by TNFRSF6/Fas-receptor, tumor necrosis factor receptor, TNFRSF25, and TNFSF10/TRAIL-receptor, and thus it participates in the death signaling initiated by these receptors. Interaction of this protein with the receptors unmasks the N-terminal effector domain of this protein, which allows it to recruit caspase-8, and thereby activate the cysteine protease cascade. Knockout studies in mice also suggest the importance of this protein in early T cell development. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77020
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
126-FL/CF
Species: Hu
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF347
Species: Hu
Applications: WB, IHC, Neut
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
H00008772-M04
Species: Hu
Applications: WB, ELISA

Publications for FADD Antibody (H00008772-M04) (0)

There are no publications for FADD Antibody (H00008772-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FADD Antibody (H00008772-M04) (0)

There are no reviews for FADD Antibody (H00008772-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FADD Antibody (H00008772-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FADD Products

Bioinformatics Tool for FADD Antibody (H00008772-M04)

Discover related pathways, diseases and genes to FADD Antibody (H00008772-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FADD Antibody (H00008772-M04)

Discover more about diseases related to FADD Antibody (H00008772-M04).
 

Pathways for FADD Antibody (H00008772-M04)

View related products by pathway.

PTMs for FADD Antibody (H00008772-M04)

Learn more about PTMs related to FADD Antibody (H00008772-M04).
 

Research Areas for FADD Antibody (H00008772-M04)

Find related products by research area.

Blogs on FADD.

Apoptosis and Necroptosis Part II: Inhibitors of apoptosis proteins (IAPs); Key regulators of the balance between necroptosis, apoptosis and survival
In the first installment of this two-part blog post titled "Apoptosis and Necroptosis: Important factors to identify both types of programmed cell death", the mechanisms by which cell death occurs and ways to identify these pathways were...  Read full blog post.

FADD - important initiator of death receptor-mediated apoptosis
FAS-associated death domain protein (FADD) is a 23 kDa adaptor protein involved in initiating apoptosis. FADD is best known for its involvement in extrinsic/death receptor-mediated apoptosis, but it is also involved in initiating necroptosis with ...  Read full blog post.

Caspase 9: The Suicidal Cell Whisperer
Cell death via apoptosis is a key cellular function triggered by the cell death receptor family and their ligands which signal through downstream adaptor molecules and the caspase protease family. Among the subclass of initiator caspases that include...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FADD Antibody (1E8.) and receive a gift card or discount.

Bioinformatics

Gene Symbol FADD
Entrez
Uniprot