Factor XII Recombinant Protein Antigen

Images

 
There are currently no images for Factor XII Protein (NBP1-86518PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Factor XII Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human F12.

Source: E. coli

Amino Acid Sequence: YHKCTHKGRPGPQPWCATTPNFDQDQRWGYCLEPKKVKDHCSKHSPCQKGGTCVNMPSGPHCLCPQHLTGNHCQKEKCFEPQLLRFFHKNEIWYRTEQAAVARCQCKGPDA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
F12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86518.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Factor XII Recombinant Protein Antigen

  • beta-factor XIIa part 1
  • coagulation factor XII (Hageman factor)
  • coagulation factor XII
  • coagulation factor XIIa heavy chain
  • coagulation factor XIIa light chain
  • EC 3.4.21
  • EC 3.4.21.38
  • F12
  • HAE3
  • HAEX
  • HAF beta-factor XIIa part 2
  • HAF
  • Hageman factor

Background

Coagulation factor XII, also called Hageman factor, circulates in blood as a zymogen. This single chain zymogen is activated by contact with negatively charged polyanions,to form a two chain serine protease containing alpha factor XIIa. The heavy chain contains two fibronectin type domains, two epidermal growth factor (EGF) like domains, a kringle domain and a proline rich domain, whereas the light chain contains only a catalytic domain. On activation, further cleavages takes place in the heavy chain, resulting in the production of beta factor XIIa light chain and the alpha factor XIIa light chain becomes beta factor XIIa heavy chain. Prekallikrein is cleaved by factor XII to form kallikrein, which then cleaves factor XII first to alpha factor XIIa and then to beta factor XIIa. The active factor XIIa participates in the initiation of blood coagulation, fibrinolysis, and the generation of bradykinin and angiotensin. It activates coagulation factors VII and XI. Defects in Factor XII gene do not cause any clinical symptoms and the sole effect is that whole blood clotting time is prolonged.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-94203
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
236-EG
Species: Hu
Applications: BA
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF1396
Species: Hu
Applications: WB
AF2498
Species: Mu
Applications: IP, WB
2914-HT
Species: Hu
Applications: BA
AF226
Species: Hu
Applications: WB
1719-SE
Species: Hu
Applications: EnzAct
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF2460
Species: Hu
Applications: IP, Neut, WB
233-FB
Species: Hu
Applications: BA
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF1148
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
AF4999
Species: Mu
Applications: Simple Western, WB
NBP1-89993
Species: Hu
Applications: IHC,  IHC-P, WB
AF2905
Species: Hu
Applications: ELISA, ICC, WB
291-G1
Species: Hu
Applications: BA
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB

Publications for Factor XII Protein (NBP1-86518PEP) (0)

There are no publications for Factor XII Protein (NBP1-86518PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Factor XII Protein (NBP1-86518PEP) (0)

There are no reviews for Factor XII Protein (NBP1-86518PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Factor XII Protein (NBP1-86518PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Factor XII Products

Research Areas for Factor XII Protein (NBP1-86518PEP)

Find related products by research area.

Blogs on Factor XII

There are no specific blogs for Factor XII, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Factor XII Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol F12