Recombinant Human Factor XII heavy chain GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Factor XII heavy chain Protein [H00002161-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human Factor XII heavy chain GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-300 of Human F12 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MPAQPAPPKPQPTTRTPPQSQTPGALPAKREQPPSLTRNGPLSCGQRLRKSLSSMTRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPEDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSPYVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREHTVS

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
F12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
58.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Factor XII heavy chain GST (N-Term) Protein

  • beta-factor XIIa part 1
  • coagulation factor XII (Hageman factor)
  • coagulation factor XII
  • coagulation factor XIIa heavy chain
  • coagulation factor XIIa light chain
  • EC 3.4.21
  • EC 3.4.21.38
  • HAE3
  • HAEX
  • HAFbeta-factor XIIa part 2
  • Hageman factor

Background

This gene encodes coagulation factor XII which circulates in blood as a zymogen. This single chain zymogen is converted to a two-chain serine protease with an heavy chain (alpha-factor XIIa) and a light chain. The heavy chain contains two fibronectin-type domains, two epidermal growth factor (EGF)-like domains, a kringle domain and a proline-rich domain, whereas the light chain contains only a catalytic domain. On activation, further cleavages takes place in the heavy chain, resulting in the production of beta-factor XIIa light chain and the alpha-factor XIIa light chain becomes beta-factor XIIa heavy chain. Prekallikrein is cleaved by factor XII to form kallikrein, which then cleaves factor XII first to alpha-factor XIIa and then to beta-factor XIIa. The active factor XIIa participates in the initiation of blood coagulation, fibrinolysis, and the generation of bradykinin and angiotensin. It activates coagulation factors VII and XI. Defects in this gene do not cause any clinical symptoms and the sole effect is that whole-blood clotting time is prolonged. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-94203
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
236-EG
Species: Hu
Applications: BA
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-89993
Species: Hu
Applications: IHC, IHC-P, WB
AF2498
Species: Mu
Applications: IP, WB
2914-HT
Species: Hu
Applications: BA
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
1719-SE
Species: Hu
Applications: EnzAct
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF2460
Species: Hu
Applications: IP, Neut, WB
233-FB
Species: Hu
Applications: BA
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF4779
Species: Hu
Applications: IHC, WB
NBP1-89993
Species: Hu
Applications: IHC, IHC-P, WB
AF2905
Species: Hu
Applications: ELISA, ICC, WB
291-G1
Species: Hu
Applications: BA
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

Publications for Factor XII heavy chain Recombinant Protein (H00002161-P01) (0)

There are no publications for Factor XII heavy chain Recombinant Protein (H00002161-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Factor XII heavy chain Recombinant Protein (H00002161-P01) (0)

There are no reviews for Factor XII heavy chain Recombinant Protein (H00002161-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Factor XII heavy chain Recombinant Protein (H00002161-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Factor XII heavy chain Products

Bioinformatics Tool for Factor XII heavy chain Recombinant Protein (H00002161-P01)

Discover related pathways, diseases and genes to Factor XII heavy chain Recombinant Protein (H00002161-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Factor XII heavy chain Recombinant Protein (H00002161-P01)

Discover more about diseases related to Factor XII heavy chain Recombinant Protein (H00002161-P01).
 

Pathways for Factor XII heavy chain Recombinant Protein (H00002161-P01)

View related products by pathway.

PTMs for Factor XII heavy chain Recombinant Protein (H00002161-P01)

Learn more about PTMs related to Factor XII heavy chain Recombinant Protein (H00002161-P01).

Blogs on Factor XII heavy chain

There are no specific blogs for Factor XII heavy chain, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Factor XII heavy chain GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol F12