Factor VIII A2 domain Antibody


Western Blot: Factor VIII A2 domain Antibody [NBP1-68934] - Sample Tissue: 721_B Whole Cell, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1ug/ml, Peptide ...read more
Western Blot: Factor VIII A2 domain Antibody [NBP1-68934] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Factor VIII A2 domain Antibody Summary

Synthetic peptides corresponding to F8 (coagulation factor VIII, procoagulant component) The peptide sequence was selected from the C terminal of F8. Peptide sequence IMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQ.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against F8 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
79 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Factor VIII A2 domain Antibody

  • AHF
  • Antihemophilic factor
  • coagulation factor VIII, procoagulant component
  • coagulation factor VIIIc
  • DXS1253E
  • F8Ccoagulation factor VIII
  • factor VIII F8B
  • Procoagulant component


This gene encodes coagulation factor VIII, which participates in the intrinsic pathway of blood coagulation; factor VIII is a cofactor for factor IXa which, in the presence of Ca+2 and phospholipids, converts factor X to the activated form Xa. This gene produces two alternatively spliced transcripts. Transcript variant 1 encodes a large glycoprotein, isoform a, which circulates in plasma and associates with von Willebrand factor in a noncovalent complex. This protein undergoes multiple cleavage events. Transcript variant 2 encodes a putative small protein, isoform b, which consists primarily of the phospholipid binding domain of factor VIIIc. This binding domain is essential for coagulant activity. Defects in this gene results in hemophilia A, a common recessive X-linked coagulation disorder.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP, ICC
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IP, Neut
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB

Publications for Factor VIII A2 domain Antibody (NBP1-68934) (0)

There are no publications for Factor VIII A2 domain Antibody (NBP1-68934).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Factor VIII A2 domain Antibody (NBP1-68934) (0)

There are no reviews for Factor VIII A2 domain Antibody (NBP1-68934). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Factor VIII A2 domain Antibody (NBP1-68934) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Factor VIII A2 domain Antibody Products

Factor VIII A2 domain NBP1-68934

Related Products by Gene

Bioinformatics Tool for Factor VIII A2 domain Antibody (NBP1-68934)

Discover related pathways, diseases and genes to Factor VIII A2 domain Antibody (NBP1-68934). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Factor VIII A2 domain Antibody (NBP1-68934)

Discover more about diseases related to Factor VIII A2 domain Antibody (NBP1-68934).

Pathways for Factor VIII A2 domain Antibody (NBP1-68934)

View related products by pathway.

PTMs for Factor VIII A2 domain Antibody (NBP1-68934)

Learn more about PTMs related to Factor VIII A2 domain Antibody (NBP1-68934).

Blogs on Factor VIII A2 domain

There are no specific blogs for Factor VIII A2 domain, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Factor VIII A2 domain Antibody and receive a gift card or discount.


Gene Symbol F8

Customers Who Bought This Also Bought