FABP6 Antibody

Images

 
Western Blot: FABP6 Antibody [H00002172-B01P] - Analysis of FABP6 expression in transfected 293T cell line by FABP6 polyclonal antibody. Lane 1: FABP6 transfected lysate(14.19 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FABP6 Antibody Summary

Immunogen
FABP6 (AAH22489, 1 a.a. - 128 a.a.) full-length human protein. MAFTGKFEMESEKNYDEFMKLLGISSDVIEKAHNFKIVTEVQQDGQDFTWSQHYYGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
Specificity
FABP6 - fatty acid binding protein 6, ileal (gastrotropin),
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
FABP6
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FABP6 Antibody

  • FABP6
  • fatty acid binding protein 6, ileal
  • Fatty acid-binding protein 6
  • Gastrotropin
  • I-15P
  • I-15PIntestinal 15 kDa protein
  • IBABP
  • I-BABPIntestinal bile acid-binding protein
  • I-BALB
  • I-BAP
  • ILBP
  • ILBP3
  • ILBPGT
  • ileal bile acid binding protein
  • ILLBP
  • ILLBPIleal lipid-binding protein
  • illeal lipid-binding protein

Background

This gene encodes the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Transcript variants generated by alternate transcription promoters and/or alternate splicing have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
MAB8400
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB6799
Species: Hu
Applications: WB, IHC
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2009
Species: Hu
Applications: WB, IHC
H00002172-B01P
Species: Hu
Applications: WB

Publications for FABP6 Antibody (H00002172-B01P) (0)

There are no publications for FABP6 Antibody (H00002172-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FABP6 Antibody (H00002172-B01P) (0)

There are no reviews for FABP6 Antibody (H00002172-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FABP6 Antibody (H00002172-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FABP6 Products

Bioinformatics Tool for FABP6 Antibody (H00002172-B01P)

Discover related pathways, diseases and genes to FABP6 Antibody (H00002172-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FABP6 Antibody (H00002172-B01P)

Discover more about diseases related to FABP6 Antibody (H00002172-B01P).
 

Pathways for FABP6 Antibody (H00002172-B01P)

View related products by pathway.

Research Areas for FABP6 Antibody (H00002172-B01P)

Find related products by research area.

Blogs on FABP6

There are no specific blogs for FABP6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FABP6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FABP6
Entrez
Uniprot