Recombinant Human FABP5/E-FABP Protein

Product Discontinued

Recombinant Human FABP5/E-FABP Protein Summary

• Description: An un-tagged recombinant protein corresponding to amino acids 1 - 135 of Human FABP5.
  
  

  Source: E.coli

  Amino Acid Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein
• Gene: FABP5
• Purity: >90%, by SDS-PAGE

Applications/Dilutions

• Dilutions:
  • SDS-Page
• Theoretical MW: 15 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: 20 mM Tris buffer (pH 8.0), 1 mM DTT, 20 % Glycerol
• Preservative: No Preservative
• Concentration: 1 mg/ml
• Purity: >90%, by SDS-PAGE

Alternate Names for Recombinant Human FABP5/E-FABP Protein

• EFABP
• E-FABP
• E-FABPPAFABP
• FABP5
• fatty acid binding protein 5 (psoriasis-associated)
• Fatty acid-binding protein 5
• PA-FABPepidermal
• Psoriasis-associated fatty acid-binding protein homolog

Background

FABP5 is a member of the intracellular fatty acid binding protein (FABP) family, which is known for the ability to specifically bind fatty acids (FAs) with high affinity for stearic and linoleic acids. FABP5 is expressed in endothelial cells of the microvasculature of the placenta, heart, skeletal muscle, small intestine, lung, and renal medulla. FABP4 and FABP5 are closely related and both are expressed in adipocytes. Absence of FABP5 resulted in increased systemic insulin sensitivity in two models of obesity and insulin resistance. Recombinant human FABP5 was expressed in E.coli and purified by conventional chromatography.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: FABP5