Recombinant Human FABP5/E-FABP Protein Summary
| Description |
An un-tagged recombinant protein corresponding to amino acids 1 - 135 of Human FABP5. Source: E.coli Amino Acid Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
FABP5 |
| Purity |
>90%, by SDS-PAGE |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
15 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
20 mM Tris buffer (pH 8.0), 1 mM DTT, 20 % Glycerol |
| Preservative |
No Preservative |
| Concentration |
1 mg/ml |
| Purity |
>90%, by SDS-PAGE |
Alternate Names for Recombinant Human FABP5/E-FABP Protein
Background
FABP5 is a member of the intracellular fatty acid binding protein (FABP) family, which is known for the ability to specifically bind fatty acids (FAs) with high affinity for stearic and linoleic acids. FABP5 is expressed in endothelial cells of the microvasculature of the placenta, heart, skeletal muscle, small intestine, lung, and renal medulla. FABP4 and FABP5 are closely related and both are expressed in adipocytes. Absence of FABP5 resulted in increased systemic insulin sensitivity in two models of obesity and insulin resistance. Recombinant human FABP5 was expressed in E.coli and purified by conventional chromatography.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, Simple Western, WB
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: IP, WB
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Publications for FABP5/E-FABP Protein (NBC1-18547) (0)
There are no publications for FABP5/E-FABP Protein (NBC1-18547).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for FABP5/E-FABP Protein (NBC1-18547) (0)
There are no reviews for FABP5/E-FABP Protein (NBC1-18547).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for FABP5/E-FABP Protein (NBC1-18547) (0)
Additional FABP5/E-FABP Products
Research Areas for FABP5/E-FABP Protein (NBC1-18547)
Find related products by research area.
|
Blogs on FABP5/E-FABP