Recombinant Human FABP5/E-FABP Protein

Images

 
SDS-Page: Fatty Acid Binding Protein 5 Protein [NBC1-18547] - FABP7, 14kDa (132aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE

Product Details

Summary
Reactivity HuSpecies Glossary
Applications PAGE
Concentration
1 mg/ml

Order Details

Recombinant Human FABP5/E-FABP Protein Summary

Description
An un-tagged recombinant protein corresponding to amino acids 1 - 135 of Human FABP5.

Source: E.coli

Amino Acid Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Protein/Peptide Type
Recombinant Protein
Gene
FABP5
Purity
>90%, by SDS-PAGE

Applications/Dilutions

Theoretical MW
15 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
20 mM Tris pH 8.0, 1 mM DTT, 20 % Glycerol
Preservative
No Preservative
Concentration
1 mg/ml
Purity
>90%, by SDS-PAGE

Alternate Names for Recombinant Human FABP5/E-FABP Protein

  • EFABP
  • E-FABP
  • E-FABPPAFABP
  • FABP5
  • fatty acid binding protein 5 (psoriasis-associated)
  • Fatty acid-binding protein 5
  • PA-FABPepidermal
  • Psoriasis-associated fatty acid-binding protein homolog

Background

FABP5 is a member of the intracellular fatty acid binding protein (FABP) family, which is known for the ability to specifically bind fatty acids (FAs) with high affinity for stearic and linoleic acids. FABP5 is expressed in endothelial cells of the microvasculature of the placenta, heart, skeletal muscle, small intestine, lung, and renal medulla. FABP4 and FABP5 are closely related and both are expressed in adipocytes. Absence of FABP5 resulted in increased systemic insulin sensitivity in two models of obesity and insulin resistance. Recombinant human FABP5 was expressed in E.coli and purified by conventional chromatography.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3166
Species: Hu
Applications: WB, Simple Western, IHC
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-87695
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1678
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-16708
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-59746
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF5866
Species: Hu
Applications: WB, IHC
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB100-2590
Species: Hu
Applications: IP (-), WB, IHC-P

Publications for FABP5/E-FABP Protein (NBC1-18547) (0)

There are no publications for FABP5/E-FABP Protein (NBC1-18547).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FABP5/E-FABP Protein (NBC1-18547) (0)

There are no reviews for FABP5/E-FABP Protein (NBC1-18547). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for FABP5/E-FABP Protein (NBC1-18547) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FABP5/E-FABP Products

Bioinformatics Tool for FABP5/E-FABP Protein (NBC1-18547)

Discover related pathways, diseases and genes to FABP5/E-FABP Protein (NBC1-18547). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FABP5/E-FABP Protein (NBC1-18547)

Discover more about diseases related to FABP5/E-FABP Protein (NBC1-18547).
 

Pathways for FABP5/E-FABP Protein (NBC1-18547)

View related products by pathway.

PTMs for FABP5/E-FABP Protein (NBC1-18547)

Learn more about PTMs related to FABP5/E-FABP Protein (NBC1-18547).
 

Research Areas for FABP5/E-FABP Protein (NBC1-18547)

Find related products by research area.

Blogs on FABP5/E-FABP

There are no specific blogs for FABP5/E-FABP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FABP5/E-FABP Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FABP5
Entrez