FABP5/E-FABP Antibody

Images

 
Western Blot: FABP5/E-FABP Antibody [H00002171-D01P] - Analysis of FABP5 expression in mouse stomach.
Western Blot: FABP5/E-FABP Antibody [H00002171-D01P] - Analysis of FABP5 expression in human kidney.
Western Blot: FABP5/E-FABP Antibody [H00002171-D01P] - Analysis of FABP5 expression in transfected 293T cell line by FABP5 polyclonal antibody.Lane 1: FABP5 transfected lysate(15.20 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FABP5/E-FABP Antibody Summary

Immunogen
FABP5 (NP_001435.1, 1 a.a. - 135 a.a.) full-length human protein. MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FABP5
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FABP5/E-FABP Antibody

  • EFABP
  • E-FABP
  • E-FABPPAFABP
  • FABP5
  • fatty acid binding protein 5 (psoriasis-associated)
  • Fatty acid-binding protein 5
  • PA-FABPepidermal
  • Psoriasis-associated fatty acid-binding protein homolog

Background

This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-27073
Species: Hu, Mu, Bv, Eq, Op, Pm
Applications: WB, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-87695
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1678
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-16708
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-59746
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF5866
Species: Hu
Applications: WB, IHC
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB100-2590
Species: Hu
Applications: IP (-), WB, IHC-P

Publications for FABP5/E-FABP Antibody (H00002171-D01P) (0)

There are no publications for FABP5/E-FABP Antibody (H00002171-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FABP5/E-FABP Antibody (H00002171-D01P) (0)

There are no reviews for FABP5/E-FABP Antibody (H00002171-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FABP5/E-FABP Antibody (H00002171-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FABP5/E-FABP Products

Bioinformatics Tool for FABP5/E-FABP Antibody (H00002171-D01P)

Discover related pathways, diseases and genes to FABP5/E-FABP Antibody (H00002171-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FABP5/E-FABP Antibody (H00002171-D01P)

Discover more about diseases related to FABP5/E-FABP Antibody (H00002171-D01P).
 

Pathways for FABP5/E-FABP Antibody (H00002171-D01P)

View related products by pathway.

PTMs for FABP5/E-FABP Antibody (H00002171-D01P)

Learn more about PTMs related to FABP5/E-FABP Antibody (H00002171-D01P).
 

Research Areas for FABP5/E-FABP Antibody (H00002171-D01P)

Find related products by research area.

Blogs on FABP5/E-FABP

There are no specific blogs for FABP5/E-FABP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FABP5/E-FABP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FABP5
Entrez
Uniprot