Recombinant Human FA2H Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human FA2H Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-372 of Human FA2H full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLVLYLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGISTKLWDYCFHTLTPEKPHLKTQ

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
FA2H
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
69.2 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FA2H Protein

  • FAAHFAXDC1
  • FAH1
  • fatty acid 2-hydroxylase
  • Fatty acid alpha-hydroxylase
  • fatty acid hydroxylase domain containing 1
  • FLJ25287
  • SCS7
  • spastic paraplegia 35 (autosomal recessive)
  • SPG35

Background

Sphingolipids are a large class of lipids found in all eukaryotic cells and are involved in numerous cellular processes. The structural diversity of sphingolipids stems from more than 300 distinct head groups, as well as from modifications of the hydrophobic ceramide moiety. FA2H catalyzes a common modification of the ceramide moiety: hydroxylation at the 2 position of the N-acyl chain. Sphingolipids containing 2-hydroxy fatty acid are common in nervous and epidermal tissue. Glycoshingolipids containing a high proportion of 2-hydroxy fatty acid are critical components of myelin, and several very long chain ceramides with 2-hydroxy fatty acids are important for the permeability barrier function of epidermis (Alderson et al., 2004 [PubMed 15337768]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2427
Species: Rt
Applications: WB, PEP-ELISA
NBP2-00735
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-606
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB110-80070
Species: Hu, Mu, Rt, Fu
Applications: WB, ICC/IF
DDX0010P-100
Species: Hu, Ca
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, Flow-CS
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF4886
Species: Mu
Applications: WB, IP
NB100-2307
Species: Hu
Applications: WB
NBP1-89783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-61816
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-56713
Species: Hu
Applications: WB, ICC/IF
NBP2-57234
Species: Hu
Applications: ICC/IF
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00079152-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for FA2H Recombinant Protein (H00079152-P01) (0)

There are no publications for FA2H Recombinant Protein (H00079152-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FA2H Recombinant Protein (H00079152-P01) (0)

There are no reviews for FA2H Recombinant Protein (H00079152-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FA2H Recombinant Protein (H00079152-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for FA2H Recombinant Protein (H00079152-P01)

Discover related pathways, diseases and genes to FA2H Recombinant Protein (H00079152-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FA2H Recombinant Protein (H00079152-P01)

Discover more about diseases related to FA2H Recombinant Protein (H00079152-P01).
 

Pathways for FA2H Recombinant Protein (H00079152-P01)

View related products by pathway.

PTMs for FA2H Recombinant Protein (H00079152-P01)

Learn more about PTMs related to FA2H Recombinant Protein (H00079152-P01).
 

Research Areas for FA2H Recombinant Protein (H00079152-P01)

Find related products by research area.

Blogs on FA2H

There are no specific blogs for FA2H, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FA2H Antibody
NBP2-37957
COX-2 Antibody
NB100-689

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FA2H Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FA2H