EYA2 Antibody

Images

 
Western Blot: EYA2 Antibody [H00002139-D01P] - Analysis of EYA2 expression in transfected 293T cell line by EYA2 polyclonal antibody.Lane 1: EYA2 transfected lysate(59.20 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

EYA2 Antibody Summary

Immunogen
EYA2 (NP_005235.3, 1 a.a. - 538 a.a.) full-length human protein. MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYGQTQYSAGIQQATPYTAYPPPAQAYGIPSYSIKTEDSLNHSPGQSGFLSYGSSFSTSPTGQSPYTYQMHGTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSADGFHSSAPGANLCLGSGVHGGVDWMRKLAFRYRRVKEMYNTYKNNVGGLIGTPKRETWLQLRAELEALTDLWLTHSLKALNLINSRPNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIYSATKTGKESCFERIMQRFGRKAVYVVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL
Specificity
EYA2 - eyes absent homolog 2 (Drosophila),
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EYA2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EYA2 Antibody

  • EAB1EC 3.1.3.48
  • eyes absent (Drosophila) homolog 2
  • eyes absent homolog 2 (Drosophila)
  • eyes absent homolog 2
  • MGC10614

Background

This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may be post-translationally modified and may play a role in eye development. A similar protein in mice can act as a transcriptional activator. Five transcript variants encoding three distinct isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-58069
Species: Hu
Applications: ICC/IF
NBP1-84264
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP1-46818
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00051804-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56511
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-27192
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB, IHC-P
113-BP/CF
Species: Hu
NBP1-52030
Species: Hu
Applications: WB, PEP-ELISA
NBP1-88111
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85548
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-00493
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-85009
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47791
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
H00002139-D01P
Species: Hu
Applications: WB

Publications for EYA2 Antibody (H00002139-D01P) (0)

There are no publications for EYA2 Antibody (H00002139-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EYA2 Antibody (H00002139-D01P) (0)

There are no reviews for EYA2 Antibody (H00002139-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for EYA2 Antibody (H00002139-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional EYA2 Products

Bioinformatics Tool for EYA2 Antibody (H00002139-D01P)

Discover related pathways, diseases and genes to EYA2 Antibody (H00002139-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for EYA2 Antibody (H00002139-D01P)

Discover more about diseases related to EYA2 Antibody (H00002139-D01P).
 

Pathways for EYA2 Antibody (H00002139-D01P)

View related products by pathway.

PTMs for EYA2 Antibody (H00002139-D01P)

Learn more about PTMs related to EYA2 Antibody (H00002139-D01P).
 

Research Areas for EYA2 Antibody (H00002139-D01P)

Find related products by research area.

Blogs on EYA2

There are no specific blogs for EYA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EYA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol EYA2
Entrez
Uniprot