Evx1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Evx1 Antibody [NBP2-55442] - Staining of human cell line RT4 shows localization to nucleoplasm.

• Reactivity: Hu, Mu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Evx1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ESRKDMVVFLDGGQLGTLVGKRVSNLSEAVGSPLPEPPEKMVPRGCLSPRAVPPATRERGGGGPEEEPVDGLAGS
• Predicted Species: Mouse (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EVX1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Evx1 Recombinant Protein Antigen (NBP2-55442PEP)

Reactivity Notes

Rat 89%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Evx1 Antibody - BSA Free

• eve, even-skipped homeo box homolog 1
• eve, even-skipped homeobox homolog 1 (Drosophila)
• eve, even-skipped homeobox homolog 1
• even-skipped homeo box 1 (homolog of Drosophila)
• even-skipped homeobox 1
• EVX-1
• homeobox even-skipped homolog protein 1

Background

The Evx1 gene encodes a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. The encoded protein may play an important role as

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EVX1