ETS2 Antibody - Azide and BSA Free

Western Blot: ETS2 Antibody [NBP3-04749] - Analysis of extracts of various cell lines, using ETS2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

Immunocytochemistry/ Immunofluorescence: ETS2 Antibody - Azide and BSA Free [NBP3-04749] - Immunofluorescence analysis of U-2 OS cells using ETS2 antibody (A7329) at dilution of 1:100. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ETS2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit ETS2 Antibody - Azide and BSA Free (NBP3-04749) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-ETS2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 76-170 of human ETS2 (NP_005230.1). KAVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATNEFSLVNVNLQRFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKEN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ETS2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Western Blot 1:500-1:2000
• Theoretical MW: 53 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for ETS2 Antibody - Azide and BSA Free

• ETS2IT1
• human erythroblastosis virus oncogene homolog 210protein C-ets-2
• oncogene ETS-2
• v-ets avian erythroblastosis virus E2 oncogene homolog 2
• v-ets avian erythroblastosis virus E26 oncogene homolog 2
• v-ets erythroblastosis virus E26 oncogene homolog 2 (avian)

Background

ETS transcriptions factors, such as ETS2, regulate numerous genes and are involved in stem cell development, cell senescence and death, and tumorigenesis. The conserved ETS domain within these proteins is a winged helix-turn-helix DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T of target genes (Dwyer et al., 2007 [PubMed 17986575]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ETS2 Antibody (NBP3-04749)(1)

Publication using NBP3-04749

• Burda JE, O'Shea TM, Ao Y et al. Divergent transcriptional regulation of astrocyte reactivity across disorders Nature May 25 2022 [PMID: 35614216] (IHC-Fr, Mouse)

Bioinformatics

• Gene Symbol: ETS2