![Immunohistochemistry-Paraffin: ETNK2 Antibody [NBP2-49248] - Staining in human kidney and lymph node tissues using anti-ETNK2 antibody. Corresponding ETNK2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ETNK2-Antibody-Immunohistochemistry-Paraffin-NBP2-49248-img0004.jpg "Immunohistochemistry-Paraffin: ETNK2 Antibody [NBP2-49248] - Staining in human kidney and lymph node tissues using anti-ETNK2 antibody. Corresponding ETNK2 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit ETNK2 Antibody - BSA Free (NBP2-49248) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SFHLRRHTPCPQCSWGMEEKAAASASCREPPGPPRAAAVAYFGISVDPDDILPGALRLIQEL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ETNK2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | human and mouse | 02/02/2021 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for ETNK2 Antibody (NBP2-49248)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 02/02/2021 |
||
| Application: | WB | |
| Species: | human and mouse |
| Gene Symbol | ETNK2 |
![Immunohistochemistry-Paraffin: ETNK2 Antibody [NBP2-49248] - Staining of human lymph node shows low expression as expected.](http://images.novusbio.com/fullsize/ETNK2-Antibody-Immunohistochemistry-Paraffin-NBP2-49248-img0003.jpg "Immunohistochemistry-Paraffin: ETNK2 Antibody [NBP2-49248] - Staining of human lymph node shows low expression as expected.")
![Immunohistochemistry-Paraffin: ETNK2 Antibody [NBP2-49248] - Staining of human kidney shows high expression.](http://images.novusbio.com/fullsize/ETNK2-Antibody-Immunohistochemistry-Paraffin-NBP2-49248-img0002.jpg "Immunohistochemistry-Paraffin: ETNK2 Antibody [NBP2-49248] - Staining of human kidney shows high expression.")
![N/A t-Plasminogen Activator/tPA [HRP]](https://images.novusbio.com/images2/DATA_tPlasminogen_Activator_DTPA00_ELISA_854.jpg)
![N/A t-Plasminogen Activator/tPA [HRP]](https://images.novusbio.com/images2/tPlasminogen_Activator_DTPA00_ELISA_510.jpg)
![Immunocytochemistry EphB3 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB3_AF432_Immunocytochemistry_10108.jpg)
![Western Blot EphB3 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB3_AF432_Western_Blot_23994.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
