ERp72 Recombinant Protein Antigen

Images

 
There are currently no images for ERp72 Protein (NBP1-84795PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ERp72 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PDIA4.

Source: E. coli

Amino Acid Sequence: KVSNDAKRYTRRPLVVVYYSVDFSFDYRAATQFWRSKVLEVAKDFPEYTFAIADEEDYAGEVKDLGLSESGEDVNAAILDESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVMDPKKD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PDIA4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84795.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ERp72 Recombinant Protein Antigen

  • Endoplasmic reticulum resident protein 70
  • Endoplasmic reticulum resident protein 72
  • ER protein 70
  • ERp70
  • ERP70ER protein 72
  • ERp72
  • ERp-72
  • ERP72EC 5.3.4.1
  • intestinal-related)
  • protein disulfide isomerase family A, member 4
  • protein disulfide isomerase related protein (calcium-binding protein
  • protein disulfide isomerase-associated 4
  • protein disulfide-isomerase A4

Background

ERp72 is an endoplasmic reticulum luminal protein that is both a stress protein and a member of the protein disulfide isomerase family of proteins. Sequence analysis of ERp72 shows that it shares sequence identity with PDI (protein disulphide isomerase) at three discrete regions, as well as containing the ER retention signal KEEL at its C-terminus. ERp72 is shown to have three copies of sequence believed to be CGHC-containing active sites, which are also found in PDI. These CGHC sites are critical sites that are involved in the protein disulphide isomerization process. These results suggest that ERp72 is a newly described member of the family of CGHC-containing proteins that functions as a molecular chaperone. This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed 12910245; Barry and Johnston PubMed: 9234514). The animal's cells produce the protein, which stimulates the animal's immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, Simple Western, WB
NBP1-84796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-89394
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB300-517
Species: Bv, Ha, Hu, Pm, Mu, Po, Pm, Rb, Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IM, IP, KD, WB
NB600-101
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PA, Simple Western, WB
NBP2-49086
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB300-619
Species: Bv, Ch, Ha, Hu, Mu, Rt
Applications: ICC, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-37761
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF1543
Species: Hu
Applications: IHC, WB
MAB8306
Species: Hu
Applications: IHC, WB
NB100-1965
Species: Av, Bv, Ch, Dr, Gp, Hu, Mu, Po, Rb, Rt, Sh, Xp, Ze
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP1-84798
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-71702
Species: Ch, Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP1-85965
Species: Hu
Applications: IHC,  IHC-P
NB600-1335
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP1-32140
Species: Hu, Mu, Pl, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-07040
Species: Hu
Applications: WB
NBP1-33076
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84795PEP
Species: Hu
Applications: AC

Publications for ERp72 Protein (NBP1-84795PEP) (0)

There are no publications for ERp72 Protein (NBP1-84795PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERp72 Protein (NBP1-84795PEP) (0)

There are no reviews for ERp72 Protein (NBP1-84795PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ERp72 Protein (NBP1-84795PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ERp72 Products

Research Areas for ERp72 Protein (NBP1-84795PEP)

Find related products by research area.

Blogs on ERp72

There are no specific blogs for ERp72, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ERp72 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PDIA4