ERK5/BMK1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ERK5/BMK1 Antibody [NBP2-58369] - Staining of human cell line HeLa shows localization to nucleoplasm. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ERK5/BMK1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ERK5/BMK1 Antibody - BSA Free (NBP2-58369) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DDEPDCAPPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMPSPWAPSGDCAMESPPPA
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAPK7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ERK5/BMK1 Recombinant Protein Antigen (NBP2-58369PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ERK5/BMK1 Antibody - BSA Free

• Big MAP kinase 1
• BMK1 kinase
• BMK1
• BMK-1
• BMK1EC 2.7.11.24
• EC 2.7.11
• ERK5
• ERK-5
• ERK5MAPK 7
• Extracellular signal-regulated kinase 5
• extracellular-signal-regulated kinase 5
• MAP kinase 7
• MAPK7
• mitogen-activated protein kinase 7
• PRKM7ERK4

Background

The extracellular signal-regulated kinase 5 (ERK5), also known as MAPK7 or big mitogen-activated protein kinase 1 (BMK1), is a member of the MAP kinase subfamily (1). ERK5 differs considerably from other MAPKs; it contains an unusually long carboxyl-terminal tail which might contribute to the regulation of its activity and/or localization. In response to extracellular signals, ERK5 translocates to the nucleus, where it regulates gene expression by phosphorylating, and activating different transcription factors (2). ERK5 also differs from other MAPKs in possessing a potent transcriptional activation domain which mediates protein-protein interactions with the myocyte enhancer factor 2 (MEF2) transcription factors (3). ERK5 is specifically activated by MAPK kinase 5 (MAP2K5/MEK5) and plays an important role in mammary epithelial proliferation, endothelial cell survival and normal embryonic development (4-5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAPK7